KEGG   Gordonia alkanivorans: C5O27_05895Help
Entry
C5O27_05895       CDS       T05876                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gav  Gordonia alkanivorans
Pathway
gav03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C5O27_05895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gav03400]
    C5O27_05895
Enzymes [BR:gav01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C5O27_05895
DNA repair and recombination proteins [BR:gav03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C5O27_05895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AZZ83574
UniProt: A0A3T0V551
LinkDB All DBs
Position
complement(1284082..1286478)
Genome map
AA seq 798 aa AA seqDB search
MAGGENLEVDGRRISITNLSKVLYPATGTRKYDVIDYYSRIADVMLPHLRNRIVTRKRWP
NGVESTPFFEKDMPDSAPDWVRRYGIQHSERVIEYALAEDRATLVWLAQMAALEIHVPQW
QLPIGPDGERMANRIVFDLDPGPRVPLHETAAVAVEIRNWLGGTTTYPVTSGGKGIHIYA
RLPKPVSSEAARKVAREVANEFARQNSDFITANMSKKIRDDKVFIDWSQNNASKTTLSPY
SLRGREQPWVAAPRTWDEIEDPKIAQLLYTEVLDRVADVGDLLGGLDAPYDDDPATDADK
HGAEEPDAGDSQAGQIINLREYRRKRDESKTPEPFGDENHRQRLRESDEDADTESETGPR
EPIFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNLPTDPDQNRLAVQTEDHPMDYADFEG
DIPAGEYGGGHVSIWDKGTFELEKWREKEVIVRLHGEKVQGRYALIRTGDKNWLAHLMTD
EPRPIVPDSLTDPRPMLATDDPIDKLNERDWAFEGKWDGYRLLVRSIGGEFRLTSRSGID
MTKDFPEFAGIADDLGLMDVVLDGEAVAIDSTGRTNFTLFTSRKHTEEQYTLKLHLFDIL
YLNGTSLLRKPWSVRRELLEELATAFRRSPYVDVPPLLPAPASAAIEYSREHNLEGVVAK
RRDSVYQQGRRSTKWLKHKNWSDIEVVVGGYRPGRGNRSHTIGSLLLGLPEETGLRYVGR
VGTGFTDAQLRALAEELEPLEISRSPFLDKLDRPIASSAVWVLPKIVGEVRFMDWTTAGH
LRHPSWRGIRRDKLPGDL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcggagagaacctggaggtcgacggccgccggatctcgatcaccaatctctcc
aaggtgctctatccggcgaccgggacccggaagtacgacgtcatcgactactactcgcgc
atcgccgacgtcatgctgccgcatctgcggaaccggatcgtcacccgcaaacgctggccc
aatggtgtcgagtcgacgccgttcttcgagaaggacatgcccgacagtgcacccgactgg
gttcgccggtacggaatccagcacagcgagcgggtcatcgagtacgcactggccgaggat
cgcgccacgctcgtgtggctggcgcagatggcggcgctggagatccacgtcccgcagtgg
caactaccgatcggccccgacggcgagcgcatggccaaccgcatcgtcttcgatctcgac
cccggtccgcgggtccccctgcacgagaccgcggccgtggcggtggagatccggaactgg
ctgggcggcaccaccacctatccggtgactagcggcggcaagggaatccacatctacgcc
cgactgcccaagccggtgagctccgaggccgcacgaaaggtggctcgcgaggtggccaac
gagttcgcccggcagaacagcgatttcatcaccgccaacatgtccaagaagatccgcgac
gacaaggtcttcatcgactggagccagaacaacgcctccaagaccacgctgtctccgtac
tcgttgcgcgggcgcgagcaaccgtgggtcgccgcgccccgcacctgggacgagatcgag
gacccgaagatcgcccagttactctacacagaggtcctcgaccgcgtcgccgacgtcggc
gatctcctcgggggtctcgacgcgccgtacgacgacgatccggccaccgacgccgacaaa
catggcgccgaggagcccgacgccggggactcgcaggcgggtcagatcatcaatctgcgg
gagtaccgtcgtaaacgggacgagtccaagacacctgaacccttcggcgacgagaaccac
cggcagcgcctgcgcgaatccgacgaggatgccgacaccgaatccgaaaccggcccgcgc
gaaccgatcttcgtcatccaggaacaccacgcgcggcgcctccactacgacttccgtctc
gaacacgacggggtgctggtctcatgggccgtcccgaagaacctgccgaccgatccggac
cagaaccggctcgcggtccagaccgaggaccatccgatggactacgccgacttcgagggt
gacatcccggccggtgagtacggcggtggtcacgtatcgatctgggacaagggcactttc
gagctggagaagtggcgggagaaagaggtcatcgtccgcctgcacggcgagaaggtgcag
ggccggtacgcactgatccgcaccggggacaagaactggctcgcccacctgatgaccgac
gagccgcgccccatcgtccccgacagcctcaccgatccgcgaccgatgctcgcgaccgat
gatccgatcgacaagctcaacgaacgggactgggcgttcgagggaaagtgggatggttat
cggctcctggtgcggtcgatcggcggcgagttccggctcacgtcccggtcgggaatcgac
atgacgaaggacttccccgaattcgcgggcatcgccgacgatctcggactgatggacgtc
gtcctcgacggcgaggcggtggccatcgactcgaccggccggacgaacttcacgctgttc
acgtcgcggaagcacaccgaggagcagtacacgctcaaactgcacctgttcgacatcctc
tatctcaacgggacgtcgttgctgcggaaaccgtggtccgtacgacgcgaactcctcgag
gaactcgcgaccgcgttccgccggtcgccgtatgtcgatgtgccgccgctgcttccggcg
cccgcgagcgcggcgatcgagtacagccgcgaacacaacctcgaaggtgttgtcgccaaa
cgacgcgactcggtgtatcagcagggccgacgctccaccaagtggctcaagcacaagaac
tggagcgacatcgaggtggtggtcggcggttaccggcccgggcgcggcaaccggtcacac
accatcgggtcgttgttgctcggactgcccgaggagaccggactgcgctacgtgggacgc
gtcggcaccgggttcaccgacgcgcaattacgggcgctagccgaagaactcgagccgctg
gagatctcgcggtcaccgttcctcgacaaactcgaccggcccatcgcgtcgagcgcggtc
tgggtgctgcccaagatcgtcggcgaggtgcgcttcatggactggaccaccgcgggccac
ctacgccacccgagctggcgcggcatccgccgggacaaactccccggagatctctga

DBGET integrated database retrieval system