KEGG   Gordonia alkanivorans: C5O27_07705Help
Entry
C5O27_07705       CDS       T05876                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gav  Gordonia alkanivorans
Pathway
gav00250  Alanine, aspartate and glutamate metabolism
gav00410  beta-Alanine metabolism
gav00640  Propanoate metabolism
gav00650  Butanoate metabolism
gav01100  Metabolic pathways
gav01120  Microbial metabolism in diverse environments
Module
gav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C5O27_07705
   00650 Butanoate metabolism
    C5O27_07705
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C5O27_07705
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C5O27_07705
Enzymes [BR:gav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C5O27_07705
Amino acid related enzymes [BR:gav01007]
 Aminotransferase (transaminase)
  Class III
   C5O27_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AZZ80961
UniProt: A0A3T0UXW9
LinkDB All DBs
Position
complement(1685493..1686800)
Genome map
AA seq 435 aa AA seqDB search
MTAGVDSPTRTHQTASLSPALKQATPVVVDHALGSWVHGTDGRDYLDFTTGIGVTSTGHC
HPHVVEAAQAQCAKVIHAQYTTVMHPPLLELTERLGAVLPAGLDSVFYANSGSEAVEAAI
RLARMATARPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVHMAPFPYAFRYGW
DTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRERADRHGI
LLILDEVQAGFGRTGRFWGHQHAEGLTPDIIVTAKGLASGFPISAIAASTELMSKAWPGS
QGGTYGGNAVAAAAAIATLEVIEAEGLVENARVRGEQLLAGLREVCAPFPGIGDVRGLGL
MAGIEFVTTDAAGNRVPDAPAAVAVQQATTAQGLLTLTCGPSANVVRLIPALVVTADEID
LGVARFGAALHAALG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgccggcgttgactcccccacccgcacccaccagacggcctcactcagtcctgcg
ctcaagcaggcgacgccggtcgtcgtcgatcatgcgctggggtcctgggtccacggcacc
gacggccgcgactacctcgacttcaccaccggcatcggcgtcaccagcaccggccactgc
cacccgcacgtggtcgaggccgcgcaggcccagtgcgccaaggtgatccacgcccagtac
acgaccgtcatgcacccgccgctgctcgagctgaccgaacgactcggtgcggtcctgccg
gccggcctggactccgttttctacgccaactcgggttcggaggccgtggaggccgcgatc
cgccttgcccgcatggcgaccgcgaggccgaacatcatcgtcttccagggcggattccac
ggccgcaccgtcgcggccgcaagcctcaccaccgcgggcacccgcttctcggccggcttc
tccccgctgatgggcggcgtgcacatggcaccgttcccctacgccttccgctacggctgg
gacaccgacactgcggtcgacttcgcgctgcgggagctcgactacctcctgcagtcgcgc
gtcgcacccaacgacaccgccgcgttcctcatcgagcccgtcctcggcgacggcggctac
ctgccgacgccgccccgattcctccaaggcctgcgcgagcgcgccgaccgccacggcatc
ctgctcatcctcgacgaggtgcaggccgggttcggtcgcaccggcagattctggggccac
cagcacgccgagggcctgacccccgacatcatcgtcaccgcaaagggtctggcgtcgggg
ttcccgatctcggcgatcgccgcgtcgaccgagctgatgagcaaggcgtggccgggctcg
cagggcggaacctacggcggcaatgccgtggccgcggcggccgcgatcgcgaccctcgag
gtcatcgaggccgagggactcgtggagaacgcccgcgtgcgcggagagcagctgctcgcc
ggcctgcgggaagtgtgcgcaccgttcccgggcatcggcgacgtccggggcctcggcctg
atggccggcatcgaattcgtcaccaccgatgccgccggcaacagggtgcccgacgcccct
gccgccgtcgcggtgcagcaggccaccacggctcagggcttgttgacgctgacctgcggg
ccgtcggccaacgtcgtccgtctcatccccgcactggtcgtgacggcggacgagatcgac
ctcggtgtcgcgcggttcggcgcggcgctgcacgccgcactgggttag

DBGET integrated database retrieval system