KEGG   Gordonia alkanivorans: C5O27_12450
Entry
C5O27_12450       CDS       T05876                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gav  Gordonia alkanivorans
Pathway
gav00300  Lysine biosynthesis
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    C5O27_12450
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_12450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_12450
Enzymes [BR:gav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     C5O27_12450
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Precursor biosynthesis
  Amino acid ligase
   C5O27_12450
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase GRASP55_65
Other DBs
NCBI-ProteinID: AZZ81782
UniProt: A0A3T0V088
LinkDB
Position
2741497..2743182
AA seq 561 aa
MTSRGSSHKGSAGRRKGRKVAGRPREIAPTSVTVLSTATGARLDLVGGADRDTSVQGVTL
RAQDVQPGDLFAALPGAATHGARFADQAVAAGATAILTDPAGRAELSRVLPPETAVAVLI
HPAPRTVLGSVSARVYGNPSQRLKLIGITGTSGKTTTSYLVEAALLAAGHSVGLIGTVET
RVNGVAQPSSLTTPEAPTLQALLASMLEDGVDVVVMEVSSHALSLGRVDGAHVAIGAFTN
LSQDHLDFHQTMRAYFDAKAQLFVPSSPNHAVRAVVCVDDEWGQRMADLARRPGEAAHLQ
PVTVSTGPTPAHWHAGPSDLTGDGTSHTPITEPDGDHVLVMPLPGRYNVANGLLAVAVAH
AAGVPISTALDAVASVSVPGRLQRVDRGQPFLALVDYAHKPGAVEAVLATLRGQLGEGPG
RVAIVVGAGGDRDAGKRPLMGEAAARGAELVIVTDDNPRSEEPAAIRSEVLAGARGVDAA
ERPAGAEPVREVGDRAAAIAEAVAWARPGDIVLVAGKGHEAGQEINGVKNPFDDRDVVAQ
ALESSTPQSASTDSVAAEGDR
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgacgtctcgtggttcctcgcacaagggatcggccggcaggcgcaaggggaggaaggtc
gccggtcgtccgcgcgagatcgcgccgacgtccgtgacggtcctgtcgacggccaccggc
gcccggctcgacctcgtcggcggcgccgatcgcgacaccagcgtccagggcgtgaccctg
cgtgcccaggacgttcagcccggcgatctgttcgcggccctgcccggtgcggccacccac
ggtgcgcggttcgccgaccaggcggtcgccgccggggcgaccgcgatcctgaccgatccg
gccggccgcgccgaactcagccgcgtcctgccgcccgagaccgccgtcgcggtcctcatc
caccccgccccgcggaccgtgctgggcagcgtcagtgcccgtgtctacggcaacccttcg
cagcggctgaagctgatcgggatcaccggcacgtcgggcaagaccaccacgtcgtatctc
gtcgaggccgccctgctcgccgccgggcactcggtggggctcatcggaaccgtcgagacc
cgcgtcaacggcgtcgcgcagccgagctcgctgacgacaccggaggccccgaccctgcag
gcgctgctggcgtcgatgctcgaggacggcgtcgacgtcgtcgtcatggaggtgtccagc
cacgcgctgtcgctggggcgcgtcgacggcgcgcacgtcgctatcggtgccttcacgaac
ctctcgcaggaccatctggacttccaccagacgatgcgcgcctacttcgacgccaaagcg
cagctgttcgtgccgtcgtcgccgaaccacgcggtacgcgccgtggtgtgcgtcgacgac
gagtgggggcagcggatggccgatctcgcccgccggcccggcgaggcggcgcacctgcag
ccggtgacggtgtcgaccggtccgacgcccgcacactggcacgcgggaccgtcggatctc
accggcgacggcacctcccacacgccgatcaccgaacccgacggcgaccacgtcctcgtc
atgcctctcccgggccgctacaacgtggccaacggcctgctggcggtcgccgtggcccat
gccgcgggtgtgccgatctccaccgcactcgacgcggtcgcgtcggtgagcgtgccggga
cgtctgcagcgggtcgatcgcggacagccgttcctcgcgctggtcgactacgcccacaaa
cccggtgccgtcgaggccgtgctcgcgaccctgcgcgggcagctcggtgagggacccggc
cgcgtggccatcgtggtcggtgccggcggcgaccgtgatgccggcaagcgtccgctgatg
ggggaggccgccgcacgcggtgccgaactcgtcatcgtcaccgacgacaacccgaggtcg
gaggaaccggccgccatccggtccgaggttctcgccggcgcccgcggcgtcgacgccgcc
gaacgcccggcaggtgccgagccggtgcgcgaggtcggggaccgcgcggccgcgatcgcc
gaggccgtcgcgtgggcacggcccggcgacatcgtgctggtcgcgggcaagggacatgag
gccgggcaggagatcaacggcgtgaagaatccgttcgacgaccgtgacgtcgtcgcacaa
gcgctggagtcgtcgaccccacagagcgcatccaccgattcggtggccgcggagggtgat
cgatga

DBGET integrated database retrieval system