KEGG   Gordonia alkanivorans: C5O27_12460
Entry
C5O27_12460       CDS       T05876                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
gav  Gordonia alkanivorans
Pathway
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
gav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_12460
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C5O27_12460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_12460
Enzymes [BR:gav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     C5O27_12460
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Precursor biosynthesis
  Glycosyltransferase
   C5O27_12460
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: AZZ81784
UniProt: A0A3T0V036
LinkDB
Position
2743798..2744895
AA seq 365 aa
MTQILLAGAIAIAVSILLTPVLIKVFSRQGFGQEIRVEGPESHQTKRGTPSMGGVAILAA
LWAGYFGSHLVGLFTDGGNGPTASGLLVLGLATALGIVGFLDDIIKIRKHRNLGLNKTAK
SIGQFIAAILFGILVLQFRNDYGLTPASTHLSYVRDIDAIGLGAVVFVVFCWLVVAAWSN
AVNFTDGLDGLAAGSMAMVLGSYVLVTFFQFVNACAGGAKPPSDIPTGCYQVRDPLDLAI
IAVAGGGACLGFLWWNAAPAKIFMGDTGSLALGGMLAGLSITTRTELLAVVIGALFVAEI
MSVVIQIAFFRTTGRRVFRMAPFHHHFELGGWAETTVIIRFWLLTAIACALGLSLFYGEF
LATNG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgacccagatcctcctcgcgggtgcgatcgcgatcgcggtgtcgatcctgctgaccccc
gtgctcatcaaggtgttctcccgtcagggattcggccaggagatccgggtcgagggcccc
gagagccaccagaccaagcgcggcacaccgtcgatgggcggcgtcgcgatcctcgccgca
ctgtgggcggggtacttcggttcgcacctggtcggcctgttcaccgacggcggcaacgga
cccaccgcgtcgggtctgctcgtgttgggcctcgcgacggcgctcggcatcgtcggcttc
ctcgacgacatcatcaagatccgcaagcaccgcaacctgggactgaacaagaccgcgaag
tcgatcgggcagttcatcgccgcgatcctgttcggcatcctggtgctgcagttccgcaac
gactacggcctcaccccggccagcacccacctcagctatgtgcgcgacatcgacgccatc
ggcctgggcgcggtggtcttcgtggtgttctgctggctggtggtcgccgcctggtccaac
gcggtgaacttcaccgacggactcgacggtctggccgccggctcgatggcgatggtcctc
gggtcctacgtcctcgtgacgttcttccagttcgtcaacgcctgcgccggcggtgccaag
ccgcccagcgacatcccgaccgggtgctaccaggtccgcgatcccctcgacctcgcgatc
atcgcggtggccggcggcggtgcctgcctcggcttcctgtggtggaacgccgcaccggcg
aagatcttcatgggtgacaccggctcgctggcgctcggcggcatgctcgccggcctgtcc
atcacgacccgtaccgaactcctcgcggtcgtcatcggcgcgttgttcgtcgccgagatc
atgtcggtggtcatccagatcgccttcttccggaccaccggccgccgtgtgttccggatg
gcgcccttccaccaccacttcgaactgggcgggtgggccgagacgacggtgatcatcagg
ttctggctgctcacggccatcgcctgtgcgctgggactgtcgctcttctacggcgagttc
ctggccaccaatggctga

DBGET integrated database retrieval system