KEGG   Gordonia alkanivorans: C5O27_12465
Entry
C5O27_12465       CDS       T05876                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
gav  Gordonia alkanivorans
Pathway
gav00471  D-Glutamine and D-glutamate metabolism
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C5O27_12465 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_12465 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_12465 (murD)
Enzymes [BR:gav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     C5O27_12465 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Precursor biosynthesis
  Amino acid ligase
   C5O27_12465 (murD)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Thi4
Other DBs
NCBI-ProteinID: AZZ81785
UniProt: A0A3T0V0L7
LinkDB
Position
2744888..2746474
AA seq 528 aa
MADPLAESPASAGDSLGLTGETVVIGGAGTAGMSAARYLITRDVRILLADDRFAARDADA
AGREAAIAAVPGVADLIAQGAEAVAISDLLADPSWTGDTAVVIVSPGFAPTHDLVAQAAA
GGVPVWGEVELAWRVDAAGLLGEPRTWLVVTGTNGKTTTTSMLADIVERSGRAGAACGNI
GLPVLDAMRATPRVDVLCAELSSFQLHWAPSVTPAAGVVLNVAEDHLDWHGTFDAYALAK
AGALRGDIAVVGLDDAVASGLPGAGRRVGFTLNPPQDGQLGVENGQLVDRAFGAGRLLSA
GVVHPAGPSGVSDALAAAALALSIGVERDAVEAALTDFRPAAHRGEVVATRDGIRFVDDS
KATNPHAAQAAVAAYDRVVLIAGGLLKGASMDGMLTAVGHRLAGVVAIGRDRELVVEAIA
RHAPEVPTVTVFTGDDGTVNVQRQGQTAPVLSSIPNSSTRASGSDPAVAVMDRAVAEAWE
LAAASDPKPDAVLLAPAAASLDMFAGYGRRGDAFAHAAQDIAGTSTSR
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggctgatccgctcgccgagagccccgcgtctgccggcgattcgctggggttgaccggg
gagaccgtggtgatcggcggtgcgggcaccgccgggatgtcggcggcgcggtatctcatc
acccgcgacgtccgcatcctgctcgccgacgaccggttcgctgcacgcgatgccgacgcc
gccggccgggaggcggcgatcgccgccgtccccggggtcgcggacctgatcgcgcagggc
gcggaggcggtcgcgatctccgatctgctcgccgacccgtcgtggaccggcgacaccgcg
gtcgtgatcgtctcgcccggattcgcacccacccacgacctcgtcgcgcaggccgcggcg
ggcggtgtgccggtgtggggtgaggtcgagttggcctggcgggtcgacgccgctggtctg
ctcggtgagccgcgcacctggctggtcgtcaccggcaccaacggcaagaccacgaccacc
tcgatgctcgccgacatcgtcgagcgctccggccgtgccggcgcggcctgcggcaacatc
ggtctgccggtcctcgacgccatgcgcgcgacgccccgcgtcgacgtgctgtgcgccgag
ttgtcgtcgttccagctgcactgggcgccgtcggtcaccccggcggccggggtggtgctc
aacgtcgccgaggaccatctcgactggcacggcaccttcgacgcctatgcgctggccaag
gcgggtgcgctgcgcggcgacatcgcggtcgtcggcctcgacgacgcggtcgcgtcgggt
ctgccgggcgcgggacgccgggtcggcttcacgctgaacccgccgcaggacggtcagctc
ggcgtcgagaacgggcaactcgtcgaccgcgccttcggtgcgggtcgtctgctgtccgcc
ggcgtcgtgcatccggccggtccgtcgggtgtctccgacgctctcgccgccgccgcactc
gcactgtcgatcggagtcgagcgcgacgccgtcgaggccgcgctcaccgatttccggccc
gccgcccaccgcggcgaggtcgtggcgacgcgcgacggcatccgcttcgtcgatgactcc
aaggccaccaacccgcatgccgcccaggccgcggtcgccgcgtacgaccgtgtggtgctg
atagcgggcggcctgctcaagggtgcgtcgatggacgggatgctcaccgcggtcggccat
cggctcgccggagtggtcgccatcggccgggatcgggaactggtcgtcgaagcgatcgcg
cgacacgccccagaagtcccaacagtcacagtattcacaggggacgatggcacggtgaac
gtgcaacgccagggtcagaccgcacccgtcctctcgtcgatcccgaactcgtcgactcga
gcctcgggatcagaccccgccgtcgccgtgatggaccgggcggtcgccgaggcgtgggag
ctcgccgcggcgagcgacccgaagcccgacgcggtgctcctcgcacccgccgcggcgtcg
ctggacatgttcgccggttacggccggcgcggtgacgcgttcgcgcacgccgcacaggac
atcgccggcacctccacctcgcggtga

DBGET integrated database retrieval system