KEGG   Gordonia alkanivorans: C5O27_12480
Entry
C5O27_12480       CDS       T05876                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
gav  Gordonia alkanivorans
Pathway
gav00471  D-Glutamine and D-glutamate metabolism
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C5O27_12480
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_12480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_12480
Enzymes [BR:gav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     C5O27_12480
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Precursor biosynthesis
  Amino acid ligase
   C5O27_12480
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_C Mur_ligase_M
Other DBs
NCBI-ProteinID: AZZ81788
UniProt: A0A3T0V0L0
LinkDB
Position
2749695..2751305
AA seq 536 aa
MSEGTTVGTGGLPPQLARVHMVGIGGAGMSGLARILLARGGQVSGSDAKNSRGILELRTR
GARVQVGHDPSALDQIPGGPSVVVTTHAAIPKTNPELVAARSRGIPILLRPRVLAQLMEG
DRTMLLAGTHGKTSTTSMAVVALQHAGSDPSFAIGGELNESGTNAHHGGDPVFVAEADES
DGSLLEYTPDVVAVTNIDADHLDFFGSIEAYVDVFDKFTERIRTGGTLVVCLDDPGSAAL
AGRVRGDLAERGVAVLGYGRGTHAGLAPGVPNVATLLSWEPRAAGGAARVRFTAPVTGPA
DETGTVVERELILPLPGEHMALNAIAAVIGAVRVNAAQTADAAGALDGILAGIGAFGGVH
RRFEFRGRRGGVEVIDDYAHHPTEVRSVLSAAQAMMAARAGPDAPRGRVIAVFQPHLYSR
TVEFADEFATALDLADTVVVADVYGAREAPIPGVSGRTIADKLTRPSVFAPDLSRLAGQV
AGLARPGDLVLTLGAGDITMQGPEILAALGADTGTERTTHANGEGPGDGGLTGRVS
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgagcgaggggacgaccgtgggaaccggaggactgccgccgcagctggcccgcgtgcac
atggtcggcatcggcggcgccggcatgtccggactggcgcgcatcctgctcgcccgcggc
ggccaggtgtccggatcggacgcgaagaacagccgcggcatcctcgaactccgcacgcgt
ggcgcccgtgtccaggtgggacacgatccgtcggcgctcgaccagatcccgggcggcccg
tcggtggtggtcaccacccacgccgccatccccaagaccaaccccgagctggtggccgcc
cgctcgcggggcatcccgatcctgctgcgcccgcgcgtgctcgcccagctcatggagggc
gaccggacgatgctgctcgccgggacccatggcaagacctcgaccacctcgatggccgtc
gtcgcccttcagcacgccggcagcgatccgtcgttcgcgatcggcggcgagctcaacgaa
tccggcaccaacgcccatcacggcggcgacccggtcttcgtggccgaggccgacgagagc
gacggttcgctgctcgagtacacgcccgacgtcgtcgccgtcaccaacatcgacgccgac
catctcgacttcttcggctcgatcgaggcctacgtcgacgtgttcgacaagttcaccgaa
cgcatccggaccggcggcaccctcgtggtctgcctcgacgatcccggatcggccgcactc
gccggacgcgtccgcggcgatctcgccgagcgcggggtcgcggtcctcggctacggccgc
ggcacccatgcgggcctcgcgcccggcgtgcccaacgtggcgaccctgctgtcgtgggag
ccgcgggccgccgggggagcggcacgggtccgcttcaccgcgccggtgaccggtcccgcc
gacgagaccggcacggtcgtcgaacgtgaactcatcctcccgctcccgggagagcacatg
gcgctcaacgcgatcgccgcggtgatcggcgccgtccgcgtcaacgccgcgcagaccgcc
gacgccgcgggtgccctcgacggaatcctcgcgggcatcggtgcgttcggcggggtccat
cgtcgcttcgagttccgcggccgccggggcggcgtcgaggtcatcgacgactacgcccac
catccgaccgaggtgcgctcggtgctgtccgcggcgcaggccatgatggccgcgcgggcc
ggccccgacgcgccgcgcggtcgcgtcatcgcggtcttccagccccacctgtactcgcgc
acggtcgagttcgccgacgagttcgccaccgccctcgacctcgccgacaccgtggtcgtc
gccgacgtctacggcgcccgcgaggcaccgataccgggtgtcagcggccggacgatcgcc
gacaagctgacccgcccgtcggtgttcgcgccggacctgtcgcggctggccggtcaggtc
gccggcctggcgcgacccggtgacctcgtgttgaccctgggtgcgggcgacatcaccatg
cagggtcccgagatcctcgccgcgctcggtgcggacaccgggaccgagcgcacgacgcac
gcgaacggtgagggccccggcgacgggggcctcacgggacgggtctcgtga

DBGET integrated database retrieval system