KEGG   Gordonia alkanivorans: C5O27_15650
Entry
C5O27_15650       CDS       T05876                                 

Definition
(GenBank) peptidase M15
  KO
K07260  zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14]
Organism
gav  Gordonia alkanivorans
Pathway
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
gav01502  Vancomycin resistance
gav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_15650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C5O27_15650
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C5O27_15650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gav01002]
    C5O27_15650
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_15650
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:gav01504]
    C5O27_15650
Enzymes [BR:gav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase
     C5O27_15650
Peptidases and inhibitors [BR:gav01002]
 Metallo peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   C5O27_15650
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Peptidoglycan biosynthesis and degradation
  Carboxypeptidase
   C5O27_15650
Antimicrobial resistance genes [BR:gav01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    C5O27_15650
SSDB
Motif
Pfam: VanY DUF3350
Other DBs
NCBI-ProteinID: AZZ82323
UniProt: A0A3T0V1N4
LinkDB
Position
3441636..3442142
AA seq 168 aa
MSNLASRLMGAALAAGAAASAVLGVGSAAAAPTVLAPGTQGLAPGLAASYTLASNEARTQ
GVPIWITSGKRSDAEQRQLWRNAIATYGSPEAARRWVLPAEESPHVRGEAVDVGPWDGAA
WLERNGHLWGLCRTFVNEWWHFELATTPGTPCPPMWPDAAVRADRRGI
NT seq 507 nt   +upstreamnt  +downstreamnt
atgagcaacctcgcgtctcgactgatgggcgccgcactcgccgcaggcgccgccgcgtct
gccgtgctcggagtcggttcggcggcggcagcgcccacggtccttgccccagggacacaa
ggcctggctcccggcctcgccgcgtcgtacacgctcgcctcgaacgaggctcggacgcag
ggtgttccgatctggatcacctcggggaagcggtcggatgccgagcaacggcagctctgg
cggaacgcgatcgccacctatggcagtcccgaggccgccagacgctgggtcctgcccgcc
gaagagtcaccgcacgttcgcggcgaggcggtcgacgtcggcccgtgggacggtgcggcc
tggctcgaacgcaacggtcacctgtgggggctgtgccggaccttcgtcaacgagtggtgg
catttcgaactcgcgaccacaccggggactccgtgtccgccgatgtggccggatgccgcg
gtccgggcggatcggcgcggaatctga

DBGET integrated database retrieval system