KEGG   Gordonia alkanivorans: C5O27_16500Help
Entry
C5O27_16500       CDS       T05876                                 

Definition
(GenBank) steroid 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
gav  Gordonia alkanivorans
Pathway
gav00071  Fatty acid degradation
gav00280  Valine, leucine and isoleucine degradation
gav00281  Geraniol degradation
gav00362  Benzoate degradation
gav00592  alpha-Linolenic acid metabolism
gav01100  Metabolic pathways
gav01110  Biosynthesis of secondary metabolites
gav01120  Microbial metabolism in diverse environments
gav01130  Biosynthesis of antibiotics
gav01212  Fatty acid metabolism
Module
gav_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C5O27_16500
   00592 alpha-Linolenic acid metabolism
    C5O27_16500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C5O27_16500
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    C5O27_16500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C5O27_16500
   00642 Ethylbenzene degradation
    C5O27_16500
Enzymes [BR:gav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     C5O27_16500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AZZ82455
UniProt: A0A3T0V2J1
LinkDB All DBs
Position
complement(3610284..3611456)
Genome map
AA seq 390 aa AA seqDB search
MATAVIVDAVRTPIGKGKPSGGLHDVHPVDLLAHSLRAIVDRTGLDPAEIDDVITGVVSQ
VGEQSFNIARRALLAAGLPESVPGVSIDRQCGSGQQAIAFAAQGIIAGTYDVVVAAGVES
MSRVPMGSAAAGTSDLNGVAFDERYPDGLVGQGISAELIAARWGIARTAIDEFSLRSHEL
AAQATKNGMFDDELAPISGLTADEGIRLGGTLESLAALRPAYYDEAIARRFPEIDWRITA
ASASQISDGSAAVLVMSEEKAAELGLRPRARIHTIAVAGDDPLLMLTAIIPATRKVLARS
GLDLADIDLFEVNEAFAPVVLAWAQELGVDLDKVNVNGGAIALGHPLGASGARLATTGLN
ALEQRGGRFLLQTMCEAGGLANATIYERLG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcagtcatcgtggacgcggtacgcacgccgatcggcaaggggaagccgtcg
ggcgggctccacgacgtccatccggtcgacttactcgcacacagcctccgggcgatcgtc
gaccgtactggcctcgatccggccgagatcgacgacgtgatcaccggagtcgtcagtcag
gtgggtgagcagagtttcaacatcgcacggcgcgccctgctggcagcaggtcttccggag
tcggtgcccggtgtgtcgatcgaccgccagtgcggcagcggtcagcaggcgatcgcattc
gccgcccaggggatcatcgcgggcacctacgacgtggtcgtggccgcaggggtcgaatcg
atgtcacgggtgccgatgggttcggccgcggccgggacgtcggacctgaacggtgtcgcg
ttcgacgagcgctatcccgacgggctcgtcgggcaggggatctccgcggaactcatcgcc
gcccggtggggaatcgcccgcaccgcgatcgacgaattctcccttcggtcacacgaattg
gcggcgcaggcgaccaaaaacgggatgttcgacgacgagctcgcaccgatctccggtctg
accgccgacgaggggatccggttgggcggcaccctcgagagtctggccgccctgcggccc
gcctattacgacgaggcgatcgcgcggcgattccccgagatcgactggaggatcaccgcc
gccagtgccagccagatcagcgatggttcggccgccgtcctcgtcatgagcgaggagaag
gcggcggagctcgggttgcggccgcgggcacggatccacaccatcgcggtcgccggcgac
gatccgctcctcatgctcaccgcgatcatcccggcgacccgaaaggtactcgcgcgcagc
ggactcgacctcgccgacatcgacctgttcgaggtcaacgaggccttcgctccggttgtc
ctggcctgggcacaggagctcggcgtcgacctcgacaaggtgaacgtcaacggcggggcg
atcgcactcggtcacccgctgggagccagcggtgcccgcctggcgaccaccgggctgaac
gcgctggaacagcggggcggacgattcctgctccagacgatgtgtgaggcaggcggtctc
gcgaacgcgacgatctacgaacgcctcggctga

DBGET integrated database retrieval system