KEGG   Gordonia alkanivorans: C5O27_18975Help
Entry
C5O27_18975       CDS       T05876                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gav  Gordonia alkanivorans
Pathway
gav00564  Glycerophospholipid metabolism
gav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C5O27_18975
Enzymes [BR:gav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C5O27_18975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 AlaDh_PNT_C HI0933_like Pyr_redox 3HCDH_N Thi4 Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AZZ82882
UniProt: A0A3T0V3F4
LinkDB All DBs
Position
complement(4177353..4179095)
Genome map
AA seq 580 aa AA seqDB search
MNTEFNPDRPADMGPLYRAEAWRRLGEEQFDVVVIGGGVVGVGAALDAATRGLRVALVEA
RDIASGTSSRSSKMFHGGLRYLEQLEFGLVREALKERELSLRLLAPHLVKPLPFLYPLTQ
RVWERPYVAAGIFLYDRMGGAKSVPGQKHVTRSGALRVAPALKRSSLIGGIRYYDTVVDD
ARHSLTVARTAANYGAVIRTSTQVIGFLRESDRVLGVRVRDTENGDVTEVRAHCVINAAG
VWTDEVQALSKQRGHFKVRASKGVHIVVPRDRIVSETAIILRTANSVLFVIPWETHWIIG
TTDTDWNLDLAHPAATRADIDYILERVNEVLVTKLNHDDIEGVYAGLRPLLAGEDDETSK
LSREHAVATVAPGLVSIAGGKYTTYRVMAADAVDACNDFIPTRVAPSITERVPLLGADGY
FALINQCEHLGERYGLHPYRVRRLLNRYGSLIDDVLYYAQEDRSLLAPLAAAPQYLRVEV
VYAAVAEAALHLEDVLARRTRIAIEYSHRGVDCAGEVADLLAPLLGWTTEKRDFEVANYI
ARVEAEVASQQQPDDDSADALRAAAPEARSEILEPVPVPE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgagttcaacccggaccggccggcggacatgggcccgctctaccgagccgaa
gcgtggcggcggctcggagaagaacagttcgacgtggtcgtgatcggcggcggggtggtc
ggcgtaggtgccgcactcgacgccgccacgcgcggtctgcgggtggcgctggtcgaggcc
cgcgacatcgcctcgggcacgtcgagccggtcgtcgaagatgttccacggtggcctgcgc
tacctggaacaactcgaattcgggctggtgcgtgaggcactcaaggagcgcgagctctca
ctacggctgctggccccgcacctcgtgaaacccctgccgttcctctatccgctgacgcag
cgggtctgggaacggccgtatgtcgcggcggggatctttctctacgaccgcatgggcggc
gccaaatcggtgcccgggcagaagcatgtgacccgttcgggtgccctccgcgtggcgccc
gcgctcaagcgcagctcgctcatcggtggaatccggtactacgacacggttgtcgacgac
gcgcggcacagtctcacggtggcccgtaccgcggccaactatggcgcggtcatccgcacc
tcgacgcaggtgatcggtttcctccgcgaatccgaccgtgtcctcggcgttcgcgtgcgc
gacaccgagaacggcgacgtcaccgaggtgcgcgcccactgcgtcatcaacgccgccggg
gtgtggaccgacgaggtgcaggcgttgtccaagcagcgcgggcacttcaaggtgcgcgcg
tcgaagggtgtgcacatcgtggtgccgcgcgaccggatcgtcagcgagaccgcgatcatc
ctgcgcaccgccaactcggtgctgttcgtcatcccgtgggagacgcactggatcatcggc
accaccgacaccgactggaacctcgacctcgcgcatccggccgccacccgggcggacatc
gactacatcctggaacgcgtcaacgaggtgctggtcaccaagctgaaccacgacgacatc
gagggcgtctacgccggtttgcgaccgctgctggcgggcgaggacgacgagacgtcgaag
ctctcgcgtgagcatgccgtcgccaccgtggcaccgggtctggtgtcgatcgcgggtggc
aagtacaccacctaccgggtcatggccgccgacgccgtcgacgcgtgcaacgacttcatt
cccacccgggtggcgccgtcgatcaccgagcgggtgccgctgctcggtgcggacggatac
ttcgcgctgatcaaccagtgcgaacatctcggggagcgatacggcctgcacccgtaccgg
gttcggcgactgctcaaccgctacggctcgctgatcgacgacgtgctctactacgcgcag
gaggacaggtcgctgctcgcaccgctggccgccgcgccgcagtatctgcgcgtcgaagtg
gtgtacgcagcggtcgccgaggccgcgctccatctcgaggacgtgctggcccggcgcacc
cggatcgcgatcgagtactcgcaccgcggcgtcgactgcgccggcgaggtcgccgatctg
ctcgcaccccttctcgggtggaccaccgagaagcgcgacttcgaggtggccaactacatc
gcgcgcgtcgaggccgaggtggcgtcgcaacagcaacccgacgacgattccgccgacgca
ctgcgggcggccgcgcccgaggcgcgttcggagattctcgagccggtacccgtcccggag
tga

DBGET integrated database retrieval system