KEGG   Gemmatirosa kalamazoonesis: J421_2532Help
Entry
J421_2532         CDS       T03025                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
gba  Gemmatirosa kalamazoonesis
Pathway
gba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gba01100  Metabolic pathways
gba01110  Biosynthesis of secondary metabolites
gba01130  Biosynthesis of antibiotics
gba01230  Biosynthesis of amino acids
Module
gba_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:gba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    J421_2532
Enzymes [BR:gba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     J421_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AHG90069
UniProt: W0RG32
LinkDB All DBs
Position
complement(2950384..2951472)
Genome map
AA seq 362 aa AA seqDB search
MTREDAAGGVLPYPVWVAPGLLADIGALVARVAPAHRYVVITDTAVGPLHGNAVAGMLPD
ALRLDVPPGESQKTRDSWARLTDAMLSAGCGRDTTVVAVGGGVVGDLAGFVAATFMRGVP
VVQVPTTLLAMVDASVGGKTAVDTPHGKNLVGAFHPPAAVVIDPLVLATLPRRELVAGLA
EVVKHGVIADAAYFDAVRAALPLLTAPDGHNATTLLAHVVAGSVATKAAIVAADEREGGM
RKILNFGHTIGHAVETLSGYSLLHGECVAIGMAMEAEAAERAGIAVAGTADAIRATLDAA
GLPRRRPAGMAPDAILEATRGDKKARAGRVEYALPERIGAMASAGGRWSMPLDDALLLEV
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgcgaggacgccgccggcggcgtcctgccctaccccgtctgggtcgcccccggg
ctgctcgcggacatcggcgcgctcgtcgcccgggtcgcgccggcccaccggtacgttgtg
atcaccgacacagcggtcgggccgctccacggcaatgctgtggctggcatgctgcccgac
gccctccgcctcgacgtcccgccgggggagtcgcagaagactcgcgacagttgggcgcgg
ctgacggacgcgatgctctcggccggttgcgggcgggacaccacggtcgtcgccgtgggg
ggtggggtggtgggtgatctcgccgggttcgtcgccgcgacgttcatgcggggcgtgccg
gtggtgcaggttccgacgacgctgctcgccatggtcgatgcgtcggtcggcggcaagacg
gccgtggacacgccgcacgggaagaacctcgtgggcgcgttccatccgccggccgccgtc
gtcatcgacccgctggtgctcgcgacgctgccgcggcgcgagctcgtcgccgggctcgcg
gaagtggtcaagcacggcgtgatcgcggacgcggcgtacttcgacgcggtgcgggcggcg
ctgccgctcctcacggcgcccgacggtcacaacgcgacgacgctcctcgcgcacgtcgtc
gccggcagcgtcgccacgaaggccgcgatcgtcgcggccgacgagcgggagggaggcatg
cgcaagatcctgaacttcggacatacgatcggacacgccgtggagacgttgagcggttac
tcgctgctccacggcgagtgcgtcgcgatcggcatggccatggaggccgaggccgccgaa
cgtgcgggcatcgctgtcgccggcaccgccgacgccatccgcgcgaccctcgacgccgcc
ggcctcccgcggcgccgtcccgccggcatggcccccgatgcgatcctggaggccacgcgc
ggcgacaagaaggcgcgcgccggccgcgtcgagtacgcgctccccgagcgcatcggcgcg
atggcgagcgccggcggccgctggtcgatgccgctcgacgacgccctcctgctggaggtg
ctcgcttga

DBGET integrated database retrieval system