KEGG   Gemmatirosa kalamazoonesis: J421_3124
Entry
J421_3124         CDS       T03025                                 

Definition
(GenBank) phosphotransferase system PTS sorbose-specific IIC subunit
  KO
K11196  fructose PTS system EIIC component
Organism
gba  Gemmatirosa kalamazoonesis
Pathway
gba00051  Fructose and mannose metabolism
gba02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:gba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    J421_3124
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    J421_3124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gba02000]
    J421_3124
Transporters [BR:gba02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    J421_3124
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AHG90661
UniProt: W0RIP8
LinkDB
Position
3634939..3635640
AA seq 233 aa
MIEPPVGLVPTSLLGALLGLDVVSFPQAMLSRPLVAATLAGALAGSAETGLIIGATLELF
ALETLPIGASRYPEWGSAAVVGGTLYAMAERSETAMTAGAMCMAVLFAIATSWVGGRSMV
LLRTINGRFARRSMDSLAAGSARTVVGLQLAGLFGDLLRGFLLTLAALLVTIPAQEAALA
RWHTDGRIARAVVVGLAAMVAGGAVWKLVHAVPRARWLFLGGLLCGLALLAFA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgatcgagccgccggtcgggctcgtgcccacgtcgctgctcggcgcgctgctcgggctc
gacgtcgtgagctttccgcaggcgatgctctcgcggccgctcgtcgccgcgacgctcgcc
ggtgcgctcgccggcagcgcagagacggggctcatcatcggggcgacgctcgagctgttc
gcgctcgagacgctgccgatcggcgcgtcgcgctaccccgagtggggctcggccgccgtc
gtcggcgggacgctgtacgcgatggccgagcgcagcgagacggcgatgaccgccggcgcg
atgtgcatggccgtgctgttcgcgatcgccacgtcgtgggtcggcggccgctccatggtg
ctgctgcgcacgatcaacggccgattcgcgcgccggtcgatggactcgctcgcggcgggg
tcggcgcgcacggtcgttggcctgcagctcgccggcctgttcggcgatctgctgcgcggc
ttcctgctcacgctcgccgcgctgctcgtgaccattccggcgcaggaggcggcgctcgcg
cgctggcacaccgacgggcgcatcgcgcgcgcggtggtcgtcggactcgccgcgatggtc
gccggcggcgcggtgtggaagctggtgcatgcggtgccgcgcgcgcggtggctctttctc
ggcgggctgctgtgcgggctcgcgctgctggcgttcgcatga

DBGET integrated database retrieval system