KEGG   Gemmatirosa kalamazoonesis: J421_3180Help
Entry
J421_3180         CDS       T03025                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gba  Gemmatirosa kalamazoonesis
Pathway
gba00970  Aminoacyl-tRNA biosynthesis
gba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    J421_3180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gba03029]
    J421_3180
Enzymes [BR:gba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     J421_3180
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     J421_3180
Mitochondrial biogenesis [BR:gba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    J421_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2067
Motif
Other DBs
NCBI-ProteinID: AHG90717
UniProt: W0RJW9
LinkDB All DBs
Position
3692914..3694392
Genome map
AA seq 492 aa AA seqDB search
MTATAPSRSASWAETYEMVVGLEVHVQLATRTKIFCNCSTNFGAEPNANTCPVCLGLPGT
LPVLNYEAVVLATRAALALGCDVHEISVFARKNYFYPDLPKGYQITQYDRPLATGGKVQI
GETPDGAPLNVGVHRVHMEEDAGKSLHDRFPGGTAIDLNRTGVPLIEIVSEPDMRSSAEA
GAYLRSLKQIIEYVGASDANMEEGSLRVDANISVRRRGDTGLGTKTEIKNMNSFAGVERA
LEAEFVRQCALIASGGAVEQQTMLWDDKRGETRPARSKEGSHDYRYFPEPDLPPLILTRE
WIEARRDELPELPAAHRERLKEAYGLGPAEVGVLAADRGVSTYFESVARIHGDAKTAAHW
VMRDVLKVLNETGHTIEEFQLQVRPADLAALLDMIRDDVVSHSAGAQIFVLMVRTGVEPQ
KIAEREGLLKVTDDAKLRAWVDEVFAEHPAEAERFAGGDRKLQGPLVGFVMKKSGGSADP
KRVNALLAERVR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccgcgccgagcaggtccgcatcgtgggccgagacgtacgagatggtcgtc
ggcctcgaggtgcacgtgcagctcgccacgcgcacgaagatcttctgcaactgctccacg
aacttcggcgccgagccgaacgcgaacacgtgccccgtgtgcctcggccttccgggtacg
ctgccggtgctgaactacgaggccgtggtgctcgcgacgcgcgccgcgctcgcgctgggc
tgcgacgtgcacgagatctcggtgttcgcgcgcaagaactacttctacccggatctgccg
aagggctaccagatcacgcagtacgaccggccgctggccaccggcggcaaggtgcagatc
ggggagacgcccgacggcgcgccgctgaacgtcggcgtgcaccgcgtgcacatggaggag
gatgccggcaagtcgctgcacgaccgcttccccggcgggaccgccatcgacctgaatcgc
accggcgtgccgctcatcgagatcgtgagcgagccggacatgcgctcgtccgcggaagcg
ggcgcgtacctgcgatcgctgaagcagatcatcgagtacgtcggcgcgagcgacgcgaac
atggaggagggctcgctgcgcgtggacgcgaacatcagcgttcggcggcggggcgacacg
gggctcggcacgaagaccgagatcaagaacatgaactccttcgccggcgtcgagcgcgcg
ctggaggcggagttcgtgcggcagtgcgctctgatcgcgtcgggcggcgccgtcgagcag
cagacgatgctgtgggacgacaagcgcggcgagacgcgtccggcgcgcagcaaggaaggg
agccacgactatcgctacttcccggagccggatctcccgccgctgattctcacgcgcgag
tggatcgaggcgcgccgcgacgagctccccgagctgcccgccgcgcaccgcgagcggctg
aaggaggcctacggcctcggccccgcggaggtcggcgtgctcgccgccgaccgcggcgtc
tcgacgtacttcgagagcgtggcgcgcatccacggcgacgcgaagacggcggcgcactgg
gtgatgcgcgacgtgctgaaggtgctgaacgagacggggcacaccatcgaggagttccag
ctccaggtgcgccccgccgacctcgccgcgttgctcgacatgatccgcgacgacgtcgtg
agccactccgccggcgcgcagatcttcgtgctgatggtccgcaccggcgtggagccgcag
aagatcgccgagcgcgaggggctgctgaaggtcaccgacgatgcgaagctgcgggcgtgg
gtcgacgaggtgttcgccgagcaccccgcggaggccgagcgcttcgccggcggcgatcgc
aagctccaggggccgctcgtcggcttcgtgatgaagaagtccggcggcagcgcggacccg
aagcgcgtgaacgccctgctcgccgaacgcgtgcgctag

DBGET integrated database retrieval system