KEGG   Gemmatirosa kalamazoonesis: J421_4010Help
Entry
J421_4010         CDS       T03025                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gba  Gemmatirosa kalamazoonesis
Pathway
gba03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    J421_4010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gba03400]
    J421_4010
Enzymes [BR:gba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     J421_4010
DNA repair and recombination proteins [BR:gba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     J421_4010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AHG91547
UniProt: W0RM59
LinkDB All DBs
Position
complement(4634186..4635163)
Genome map
AA seq 325 aa AA seqDB search
MYASTGATLPTGPGWTFEPKYDGIRVIAVATAGEARLFTRNGNDKSRQFPEIAAALRALA
ARAGRSLVLDGEVVALDAGEPARFQALQSRMHVEDPRAVALHATQAPSALVAFDLLLDGD
EPLIARPWRERRTRLERVLGRRGRGGKGGRLRLGHTEADGAALLARARDAGWEGILAKRT
DATYAPGVRTRHWLKLKVEQRQEFVVGGYTEPRESRKHLGALLLGYYDRDGRFVYAGHTG
GGFTHAGLADMARRLRPLARATSPFTEAIKTNAPAHWVRPEVVVEVKFSEWTADGRLRQP
IFVGVRDDKPARDVRREPVARSGAA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgagcaccggcgcgacgctgccgacgggtccgggctggacgttcgagccgaag
tacgatggcatccgcgtgatcgccgtcgcgaccgccggcgaggcgcgcctgttcacgcgg
aacggcaacgacaagtcccgccagttccccgagatcgccgccgcgctccgcgcgctcgcc
gcgcgggcaggccgctcgctggtgctcgacggcgaggtcgtcgcgctcgatgcgggcgag
cccgcgcgcttccaggcgctgcagtcgcgcatgcacgtggaggatccgcgtgcggtcgcg
ctgcacgccacgcaggcgccgagcgcgctcgtcgcgttcgacctgctgctcgacggcgac
gagccgctgatcgcgcgcccgtggcgcgagcgccggacgcggctcgagcgcgtcctcggg
cgccgggggcgcggcgggaaggggggccgcctgcgactcggccacaccgaggccgacggt
gcggcgctgctcgcacgcgcacgcgacgcggggtgggaggggatcctcgccaagcgcacc
gacgccacgtatgcgcccggcgtgcgcacccgccactggctcaagctgaaggtggagcag
cgccaggagttcgtcgtcggcggctacacggagccgcgcgagagccgcaagcatctcggc
gcgctgctgctcggctactacgaccgcgacggccgcttcgtctacgcgggccataccggc
ggcgggttcacgcacgccggcctggccgacatggcgcggcgcctcaggccgctcgcgcgc
gccacatcgccgttcaccgaggcgatcaagacgaacgcgcccgcgcactgggtgcggccg
gaggtggtcgtcgaggtgaagttcagcgagtggaccgccgacggtcggctgcggcagccg
atcttcgtcggggtgcgcgacgacaagccggcgcgagacgtccggcgcgagccggtcgcg
cggagcggcgccgcctaa

DBGET integrated database retrieval system