KEGG   Gemmatirosa kalamazoonesis: J421_6202Help
Entry
J421_6202         CDS       T03025                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gba  Gemmatirosa kalamazoonesis
Pathway
gba00010  Glycolysis / Gluconeogenesis
gba00071  Fatty acid degradation
gba00350  Tyrosine metabolism
gba00625  Chloroalkane and chloroalkene degradation
gba00626  Naphthalene degradation
gba01100  Metabolic pathways
gba01110  Biosynthesis of secondary metabolites
gba01120  Microbial metabolism in diverse environments
gba01130  Biosynthesis of antibiotics
gba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J421_6202
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J421_6202
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    J421_6202
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    J421_6202
   00626 Naphthalene degradation
    J421_6202
Enzymes [BR:gba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     J421_6202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AHG93737
UniProt: W0RTG9
LinkDB All DBs
Position
p2:complement(808251..809288)
Genome map
AA seq 345 aa AA seqDB search
MRALRLTAPGHPVELHDVPVPALGPRDVLVRVRAAGICHSDAHYRAGRSPARPLPLVLGH
EVAGVVERVGEMVTLVRPGDRVCLHYLIACADCWHCSRGSEQFCRTGSMIGHFRDGGWAE
YIAVPERNAVRLPDEIPLEHGAVLMCSSATSLHALRKGRIVGGDRVAVFGVGGLGMSAVQ
LARALGALDVFAVDLDDAKLAMAESFGAIPISARGADPVATILERTGGAGVDVALELIGL
PLTMRQAVQALGVQGRAVVAGLADRPLELDTYRDLLGKEAELIGANDHLLQELPLLLELA
RRRALDLARVVARTVPLDADAVNAVLDELDRFGAPVRTVIVPDPA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactccgactcaccgcccccggccacccggtcgagctgcacgacgtccccgtt
cccgcgttaggcccgcgcgacgtcctcgtgcgcgtgcgcgcggccggcatctgccactcg
gacgcgcactaccgcgcggggcgctcgcccgcgcgcccgctgccgctcgtgctcggccac
gaggtcgccggcgtcgtggagcgcgtgggcgagatggtcacgctcgtgcgcccgggcgac
cgcgtgtgcctgcactacctcatcgcgtgcgccgactgctggcactgcagccgcgggagc
gagcagttctgccgcacgggatcgatgatcggccacttccgtgacggcggatgggcggag
tacatcgccgtccccgagcgcaacgccgtgcggctgcccgacgagatcccgctcgagcac
ggcgcggtgctcatgtgctcgagcgcgacgtcgctgcacgcgctgcggaagggacggatc
gtcggcggggaccgcgtcgcggtgttcggcgtcggcgggctcgggatgtcggccgtgcag
ctcgcgcgcgcgttgggcgcgctcgacgtgttcgccgtggatctcgacgacgccaagctg
gcgatggcggagagcttcggcgcgatcccgatctcggcgcgcggcgcggatcccgtcgcg
acgatcctggaacgcaccggcggcgcgggggtcgacgtcgcgctggagctcatcgggctg
ccgctgacgatgcgccaggcggtgcaggcgctcggcgtgcagggacgcgcggtggtcgcg
gggctcgccgaccggccgctggagctcgacacgtatcgcgacctgctcggcaaggaggcg
gagctgatcggcgcgaacgatcatctcttgcaggagctgccgctgctcctcgagctcgcg
cggcgccgcgcgctggatctcgcgcgcgtcgtggcgcgcaccgtgccgctggacgccgat
gcggtgaacgcggtgctcgacgagctcgatcgcttcggcgcgccggtgcgcaccgtcatc
gtccccgaccccgcctaa

DBGET integrated database retrieval system