KEGG   Granulibacter bethesdensis CGDNIH3: GbCGDNIH3_0751Help
Entry
GbCGDNIH3_0751    CDS       T03155                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gbc  Granulibacter bethesdensis CGDNIH3
Pathway
gbc00500  Starch and sucrose metabolism
gbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GbCGDNIH3_0751
Enzymes [BR:gbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GbCGDNIH3_0751
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GbCGDNIH3_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AHJ62570
UniProt: W6I4G4
LinkDB All DBs
Position
complement(897431..900937)
Genome map
AA seq 1168 aa AA seqDB search
MISSGPERSSISGLIHGRAPMPSGAPDPPSDNTAGGKSDQIFPCALTGLKTKLIGVHMSK
NTALSPIEDPLWYKDAIIYQLHVKSFFDGDNDGIGDFKGLLSKLDYIAELGVTAIWLLPF
YPSPRRDDGYDIADYRGVHKDYGSLADFRRFVAEAHARGLRVITELVVNHTSDQHPWFKK
ARESKPGSAARNFYVWSDDDKKYSGTRIIFLDTEKSNWTWDETAKAYFWHRFYSHQPDLN
FDNPRVLQEVLSVMRFWLDIGVDGLRLDAVPYLVEREGTNNENLPETHDILKRIRAELDA
HAPGRMLLAEANQWPEDAQQYFGEGDECHMSFHFPLMPRMYMAIAREDRFPVTDIMRQTP
EIPALCQWAVFLRNHDELTLEMVTDSERDYLWSTYAADRRARINLGIRRRLAPLLEHDRR
RIELMNGLLLSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRANPAAL
VLPTIMDPVYGFQAVNVEAQAADQHSLLNWMRRMLAVRRQFTAFGRGTLRFLYPENRKVL
AYLREHEDSGNEQTILCICNLSRSAQAVELDISAFSGRVPVDMVGGSAFPPVGQLPYLLT
LPPYGFFWFVLAQSEHLPHWYTPPSESLPDYATVVIRSDISEVLEAQNRKILETESLPAY
LPKRRWFGAKGERVKAARFAYMARLGGHEGDPVLLGEVEVQLGSFTERYTLPLGIVWEDD
ISSPLVAQLALARVRRGRRVGYLTDAFAVDSLTGALMTSLRRAANNHSSLSVDDGTIEFR
PTPLLAEVTLPPEPEIRRLSAEQSNSSLILGETIVFKLIRRVSSGIHPEGEMTRVLTERG
FANTAPLYGEMVRIGPDGTPHTLALAQGFVRNQGDAWQWTLDFLSRAVEEYAVTGRNGTT
ESDLFGGYNVLASAIGRRLAEMHAILTWPDDNPDFSPVAVDVHDLQGWADSAREQLRDAF
RLLHGMTEFASNETADQVRALLAQEAEIVERLDTLATKGAGAIKTRIHGDFHLGQVLVVQ
DDAYLIDFEGEPARPLEQRRAKGNGLRDVAGLLRSFDYAASSGGMSLTIAGAAQMTERRD
HLLQQFRQSATRSFLDAYLEVLRSADTPWVQPEGIEPLLTLFLIEKAAYEIRYEAANRPG
WIGIPVAGLYHLVFGASPSSPATDEGHS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatctggaccggaaagatccagcatatccggcttgatccatggacgcgcccct
atgccatctggcgcgccagatccgccatctgacaacactgccggcgggaagtctgaccaa
atttttccttgtgctttgactggcctgaagaccaagttgattggagttcacatgagcaaa
aacaccgcactgtcacccattgaagatccactctggtacaaagatgcaatcatctaccag
ttgcacgtcaaatcattcttcgatggcgacaatgacggaattggtgactttaaaggactt
ctttcaaaactcgactatattgccgagctcggggtcacggccatatggctgctgcctttc
tatccttctccccggcgcgatgacggatatgatattgccgattacaggggggtccataaa
gattacggatcactggccgatttccgccgctttgtagccgaagctcatgcgcgcgggctg
agggtgattacggagctggtggtcaatcatacgtccgaccaacacccatggttcaaaaaa
gcccgggaaagtaagcccggatcggcagcacgcaatttttatgtctggtccgatgacgac
aaaaaatatagcggcaccagaattatctttctcgacacagagaaatccaactggacatgg
gatgaaacggccaaagcctatttctggcaccgcttctactcccaccagcctgatctgaat
ttcgataatcctcgcgtcttgcaggaagttctgtcggtgatgcggttctggctggatatc
ggcgttgatggattgcgccttgatgccgtgccttatctggtggagcgagagggcaccaat
aatgaaaaccttcctgaaacgcacgatattctgaaacgcattcgcgctgaactcgatgcg
catgcaccgggcagaatgctgctggcagaggccaatcaatggccggaagacgcgcagcaa
tatttcggcgagggcgatgaatgccatatgtcgtttcattttccgctcatgccccgcatg
tatatggccattgcacgggaggaccgcttcccggtcaccgacatcatgcggcagacacct
gaaattccagctctctgtcagtgggcggtgtttctgcgcaaccatgacgagctgacgctg
gaaatggtcacggatagcgaacgagactatctatggagcacgtacgctgctgaccgcagg
gcgcgcatcaatctgggtattcgccgccgcctggcaccgctgctggaacatgaccgccgc
cgcatcgaattgatgaacgggctgctgctctccatgccgggaacgccggttatttattac
ggcgatgaaatcggtatgggcgacaatatccatctcggcgaccgtgatggggtgcgcacg
ccgatgcaatggtccagcgaccgcaatggcggtttttcccgtgctaatccggcagcactg
gttctgccgacgatcatggacccagtctatggatttcaggccgtcaatgtggaagcgcag
gcagcggaccagcattccctgctgaactggatgcgccgcatgttggcggtacgcaggcag
ttcacggctttcgggcgcggcacgctgcgtttcctgtatccggagaaccgtaaagttctg
gcctatctgcgtgaacatgaggatagcggcaatgagcagaccattctctgtatctgcaat
ctgtcccgctcggcgcaggcagtcgagctggacatcagcgccttcagtggacgcgtcccg
gtggacatggtcggtggctctgcttttccccccgttgggcaattgccgtatctgttgacg
ctacccccttatggtttcttctggttcgtgctggcccagagcgagcatctgccacattgg
tacacgcccccatctgaatccctgccggattatgcaacggtggtgatccgttccgacatc
agcgaggttctggaagcacagaaccgcaaaattctggaaactgaaagcctccccgcctat
ctgccaaaacggcgctggttcggcgcgaaaggcgaaagggttaaagccgcacgctttgcc
tacatggcccgtctcggcggccatgagggtgatccggtgctgctgggtgaggtcgaagtt
cagctcggctcatttaccgaacgttatacgcttccactcggtattgtgtgggaggatgat
atcagcagcccgctggtcgcacagcttgccctggcccgtgtacgacgtggacgaagggtg
ggctatcttaccgatgccttcgcggtggacagcctgacgggcgcactgatgacaagcctg
cgccgtgctgccaataatcacagctcattgagcgtggatgatggcacaatagaatttcgc
ccgaccccccttctggcggaggttacgctgccaccagagccggaaatccgacgcctgtca
gccgaacagtcgaattcttcgctgattttgggagaaacgatcgtattcaagctgatccgt
cgtgtcagcagcggtatccatcccgagggcgagatgacgcgggtgctgactgaacgcggt
tttgcgaatacagcaccgctttatggcgagatggtgcggatcggccccgatggcacaccg
catacgctggcgctggcacagggcttcgtgcgcaaccagggtgatgcgtggcaatggacg
ctggacttcctcagccgggcggtggaggaatatgccgtcaccggtcgcaatggcacaacg
gaaagtgacctgttcggcggttataatgtgctggcctccgctatcggccgtcgtcttgcg
gaaatgcatgcgatcctgacatggcccgatgacaatcctgatttcagccctgttgccgtc
gatgtccatgacttgcaaggctgggccgacagtgcgcgggaacagttgcgcgacgccttc
cgcctgctgcatggcatgacggagtttgcttccaacgaaactgccgatcaggtcagagct
ctgctggctcaggaggcggaaatagtggaacgcctcgatacactcgccacaaagggagca
ggcgcaataaagacccggattcacggggatttccatcttggacaagtgctggtcgtgcag
gatgacgcctacctgatcgatttcgagggcgagcctgcccgtccgctggagcagcgacgc
gccaaaggcaatggtttgcgagacgttgcgggtttgctgcgcagttttgactatgcggcc
tcctccggcggcatgtcgctgaccattgccggcgctgcacagatgacggaacgacgggat
catttgttgcaacagttccggcagagtgccacacgcagtttccttgatgcctatctggag
gttttgcgttcagcagatacgccctgggttcagccggaagggatcgagccactgctgacg
ctgttcctgattgaaaaagctgcctacgaaatacgctacgaagccgccaaccggccgggc
tggatcggcattccagtggcggggctgtaccatctggttttcggtgcatccccctcctct
ccggctaccgatgaaggacattcctga

DBGET integrated database retrieval system