KEGG   Granulibacter bethesdensis NIH3.1: GbCGDNIH3_2077Help
Entry
GbCGDNIH3_2077    CDS       T03155                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gbc  Granulibacter bethesdensis NIH3.1
Pathway
gbc00020  Citrate cycle (TCA cycle)
gbc00190  Oxidative phosphorylation
gbc00650  Butanoate metabolism
gbc01100  Metabolic pathways
gbc01110  Biosynthesis of secondary metabolites
gbc01120  Microbial metabolism in diverse environments
gbc01130  Biosynthesis of antibiotics
gbc01200  Carbon metabolism
Module
gbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gbc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GbCGDNIH3_2077
   00650 Butanoate metabolism
    GbCGDNIH3_2077
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GbCGDNIH3_2077
Enzymes [BR:gbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GbCGDNIH3_2077
    1.3.5.4  fumarate reductase (quinol)
     GbCGDNIH3_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AHJ63970
UniProt: W6I8E0
LinkDB All DBs
Position
complement(2336556..2337338)
Genome map
AA seq 260 aa AA seqDB search
MVEFALPKNSKIGKGRTFKAPAGATRVKEFKIYRWNPDDGNNPVVDTYEIDLDQCGPMVL
DALIKIKNEVDTTLAFRRSCREGICGSCAMNIDGGNTLACLKPIEDVKGACNVNPLPHMA
VVRDLIPDLTQAYAQLRSIEPWLKSDTPPPPDAERRQSREERAELDGMWECILCFCCTTS
CPSYWWNGDRYLGPATLLAAYRWIADSRDEATGERLDALEDPFKLYRCHTIMNCAQTCPK
GLNPAKAIGEIKKLLAERQA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattcgcgctgcccaaaaacagcaaaattggcaaaggccgcacgttcaaggcg
cctgcgggtgcgacgcgggtcaaggaattcaagatttatcgctggaacccggatgacggg
aataatccggtggtcgatacctacgagatcgatctggatcagtgcgggccgatggttctg
gatgcgctgatcaagatcaagaacgaggtcgatacgaccctcgccttccgccgctcctgc
cgggagggcatttgtggctcctgcgccatgaacatcgatggtggcaatacgctggcctgt
ctgaagccgatcgaggatgtgaagggggcctgcaacgtcaatccgctgccgcatatggcg
gtggtgcgcgatctgatcccggatctgacgcaggcttatgcgcagttgcgcagcatcgag
ccgtggctgaaatccgatacgcccccgccgcccgatgccgagcgtcgccagagccgtgag
gaaagggccgagctggatggcatgtgggaatgcatcctgtgcttctgctgcaccacgtcc
tgccccagctactggtggaatggcgaccgctatctgggtccggccacgctgctggccgcg
tatcgctggattgccgacagccgtgacgaggcgaccggtgagcgtctggatgcgctggaa
gatccgttcaagctgtatcgctgccacaccatcatgaactgtgcgcagacctgcccgaaa
ggcctgaaccccgccaaggcgatcggcgagatcaagaagctgctggctgaacgtcaggcc
tga

DBGET integrated database retrieval system