KEGG   Granulibacter bethesdensis CGDNIH3: GbCGDNIH3_2078Help
Entry
GbCGDNIH3_2078    CDS       T03155                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gbc  Granulibacter bethesdensis CGDNIH3
Pathway
gbc00020  Citrate cycle (TCA cycle)
gbc00190  Oxidative phosphorylation
gbc00650  Butanoate metabolism
gbc01100  Metabolic pathways
gbc01110  Biosynthesis of secondary metabolites
gbc01120  Microbial metabolism in diverse environments
gbc01130  Biosynthesis of antibiotics
gbc01200  Carbon metabolism
Module
gbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gbc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GbCGDNIH3_2078
   00650 Butanoate metabolism
    GbCGDNIH3_2078
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GbCGDNIH3_2078
Enzymes [BR:gbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GbCGDNIH3_2078
    1.3.5.4  fumarate reductase (quinol)
     GbCGDNIH3_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHJ63971
UniProt: W6I776
LinkDB All DBs
Position
complement(2337359..2339170)
Genome map
AA seq 603 aa AA seqDB search
MNAITSPSTGAYRIVDHTYDVVVVGAGGAGLRATLGMGAAGLKTACVTKVFPTRSHTVAA
QGGISAALGNITPDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIYELEHFGVPFSRT
EDGRIYQRPFGGHMRDYGKEPVQRACAAADRTGHAMLHTLYQQSLKHHCEFFVEYFALDL
IMDDEGACRGVIAWNLEDGTMHRFRAHMVVLATGGYGRAYQSCTSAHTCTGDGGGMVLRA
GLPTQDMEFVQFHPTGIFPAGCLITEGARGEGGYLTNAAGERFMERYAPTAKDLASRDVV
SRSMTIEINEGRGVGPNKDHILLHLEHLGAEILAERLPGISETAKVFAGVDVTKEPIPVL
PTVHYNMGGIPTNYRAEVLRPTADNPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLVV
FGRAAAHRAAEIVKPGAQHAPLPARAGEAALDRLDSRRHASGGSRVADLRAELQRTMQRH
AAVFRNSASLTEGVKKMKTVWGGLSDVSVTDRSLIWNTDLVEALELDNLMGNAAATMVSA
EARPESRGAHAHDDYPDRNDQDWMKHTLSWVDASGDVHLGYRPVKMQTLTNEVSVFPPKK
RVY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgataacgtctccctccaccggcgcttacagaatcgtcgatcacacctacgat
gtcgttgtcgtcggcgccggcggtgccggccttcgtgcgacgctgggtatgggtgccgcc
gggctgaaaaccgcctgcgtcaccaaggtcttcccgacccgcagccataccgtggcggcg
cagggcggcatcagtgcggcgctgggcaatatcacgcccgatgactggcgctggcatatg
tacgacacggtgaaaggctccgactggctcggggatcaggacgccatcgaatatatgtgc
cgcgaggctattcctgcgatttacgagcttgaacatttcggggtgccgttcagccgcacc
gaggatgggcgtatttatcagcgcccgttcggcggccatatgcgggattacggcaaagag
ccggtacagcgtgcctgcgccgcagccgaccggaccggccatgcgatgctgcacacgctg
tatcagcagagcctgaagcatcattgcgaattcttcgtcgagtatttcgcgctcgatctg
atcatggacgatgaaggtgcctgccgtggcgtcatcgcctggaatctggaagatggtacc
atgcaccgcttccgcgcgcatatggtggtgctggcgactggtggttacggacgcgcctac
cagtcctgcacctctgcccatacctgtaccggcgatggtggcggcatggtgctgcgcgcg
ggcctgccaactcaggatatggagttcgtgcagttccatccgaccggtatctttcccgcc
ggatgcctgattacggagggcgcgcgcggtgaaggcggctacctgaccaatgcagccggt
gagcgcttcatggaacgctatgcgccgactgcgaaagatctggcgagtcgggacgtggtc
agccgctccatgaccatcgaaatcaatgaagggcggggtgtcggtccgaacaaggatcac
atcctgctgcatctggagcatctcggagccgagatcctcgccgagcgcctgcccggcatt
tccgaaaccgccaaggtgtttgccggtgtggatgtgacgaaggaaccgattccggttctg
ccgaccgttcactacaatatgggcggcattcccacgaattatcgcgccgaagtgttgcgt
ccgacggcggacaatcccgatgcggtggtgccgggcctgatggcggtgggtgaggcggcc
tgcgtgtccgtgcatggtgcgaaccgtctcggtaccaattccctgctcgatctggtggtg
tttggtcgtgccgcagcgcatcgcgcggcagagatcgtcaagccgggcgcgcagcacgca
ccgctgcccgcgcgtgcgggagaggccgcgctggatcgcctcgattcccgtcgtcatgcc
agtggtggttcccgcgtggcggatctgcgcgccgaattgcagcgcacgatgcagcgtcat
gccgccgtgttccgcaacagcgccagcctgaccgagggcgtgaagaagatgaagacggtg
tggggcggcctgtcggatgtctccgtcaccgatcgcagcctgatctggaacaccgatctg
gtggaagcgctggagctggacaatttgatgggcaacgcggccgccaccatggtcagcgcc
gaggcccgtccggaaagccgtggcgcccatgcgcatgacgattatccggatcgcaacgat
caggactggatgaagcacaccctgtcctgggtggacgcgagtggcgatgtgcatctgggc
tatcgccccgtgaaaatgcagaccctgaccaacgaggtctcggtcttcccgcccaagaag
cgcgtgtactga

DBGET integrated database retrieval system