KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0953Help
Entry
GbCGDNIH1_0953    CDS       T00392                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00970  Aminoacyl-tRNA biosynthesis
gbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GbCGDNIH1_0953
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gbe03029]
    GbCGDNIH1_0953
Enzymes [BR:gbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GbCGDNIH1_0953
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GbCGDNIH1_0953
Mitochondrial biogenesis [BR:gbe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GbCGDNIH1_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABI61851
UniProt: Q0BTK1
LinkDB All DBs
Position
1091576..1093027
Genome map
AA seq 483 aa AA seqDB search
MSYTIEGATGAWELVIGLEVHAQVISQSKLFSGAATAFGAEPNSQVSLVDAALPGMLPVL
NRECVAQAVRTGLGLKAHINPVSRFDRKNYFYADLPQGYQISQFAHPIVGSGTIEIELQD
GSTRQIGVTRLHLEQDAGKSLHDQDPTRSFIDLNRSGVALMEIVSEPDMRSPEEAGAYLR
KLRTILRYLGTCDGNMEEGSMRADVNVSVRRAGEPFRTRCEIKNVNSIRYVMQAIEAEAK
RQIAIWEEGEEVDQETRLFDPSRGETRSMRSKEDAHDYRYFPDPDLLPLVLDEDWIEGLK
ASLPELPDEKSARFVSEYGLTRYDAGVLVAEQASAHFFETVAKGRDARLAANYITGDLFA
VLNRTGRSITDSPISAEALGGLLDLLADNTINGRIAKEVFEAMAETGEHPADIVEARGLR
QVTDTGAIDTAVAQVLEANPDKLAEYRSGKDKLFGFFVGQVMKAMQGKGNPALVNEALKK
ALG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacgattgagggcgcaaccggcgcatgggaactggtgatcgggctggaggtt
catgcccaggtcatcagccagtccaagctcttcagcggcgcggcaacggcgttcggtgcg
gagccgaactcccaggtcagtctggtggatgccgctctgcccggtatgctgcctgtgctg
aacagggaatgtgtcgcgcaggcggtccgcaccgggctgggcctgaaggcgcatatcaat
ccggtcagccgtttcgaccggaagaactatttctatgccgatctgccacagggttatcag
atcagccagtttgcacatccgattgtcggctctggcacgatcgagatcgaattgcaggac
ggctccacgcgccagatcggggtaacccggctgcatctggagcaggatgccggtaaatcc
ctgcatgatcaggatccgacccgcagcttcatcgacctgaaccgctcgggcgttgcgctg
atggagatcgtcagcgagccggatatgcgcagcccggaggaggctggcgcctatctgcgt
aaattgcggacgatcctgcgttacctcggcacctgtgacggcaatatggaggaaggctcc
atgcgtgccgacgtgaacgtgtcggtgcggcgtgccggagagccattccgcacacgctgc
gaaatcaagaacgtcaactcgatccgctatgtgatgcaggcgatcgaggctgaggcgaag
cgccagatcgcgatttgggaagaaggggaggaggtcgatcaggaaacacgcctgttcgat
ccgtcacgcggcgagacccggtccatgcgcagcaaggaagacgcgcatgattaccgctat
ttccccgatcccgatctgctgccgttggttctggatgaggactggatcgaggggctgaaa
gcgtccctgccggagcttccggatgaaaaaagcgcgcgcttcgtctccgaatacgggctg
acccggtatgatgcgggcgtgctggtggcggaacaggccagcgcccatttcttcgagact
gtggcaaaggggcgtgatgcccgtctggcggcgaattacatcactggcgatctgttcgcc
gtgctgaatcgcaccgggcgcagcattaccgacagcccgatttcagcggaggcgctgggc
ggtctgctcgatctgctggccgacaacaccatcaatggccgtatcgccaaggaagtgttc
gaggccatggccgaaaccggagagcatccggcggatattgtcgaagcccgtgggctgcgt
caggtgactgataccggagcgatcgatacggcggtggcgcaggttctggaggccaatccc
gacaagctggcggaatatcgctccggcaaggacaagctgttcggcttcttcgtcggtcag
gtgatgaaggccatgcagggcaaaggcaatcccgctctggtcaacgaggcgttgaaaaag
gcgctcggctga

DBGET integrated database retrieval system