KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1334Help
Entry
GbCGDNIH1_1334    CDS       T00392                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00620  Pyruvate metabolism
gbe00680  Methane metabolism
gbe01100  Metabolic pathways
gbe01120  Microbial metabolism in diverse environments
gbe01200  Carbon metabolism
Module
gbe_M00168  CAM (Crassulacean acid metabolism), dark
gbe_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:gbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH1_1334
  09102 Energy metabolism
   00680 Methane metabolism
    GbCGDNIH1_1334
Enzymes [BR:gbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GbCGDNIH1_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ABI62232
UniProt: Q0BSH0
LinkDB All DBs
Position
complement(1486727..1489540)
Genome map
AA seq 937 aa AA seqDB search
MHKIPVMADMHDTQAPADLAAELLSVTERSVERSTEDPFGNPMLSVALAIARRIESGSLS
HASLVALVKHLRDAAYLDRARRLANYVGGIEGADEALAHVARRVVRPDPNDSPISFRDFQ
PEVERTRFAAVFTAHPTFSMPAEVGHALAEAAGGAEVSSFESHRPPSVTLEDEFDQAVAA
IINGRDAIDQLNRNLLVAARDVWPDRWSDLTPRPVILTSWVGYDTDGRTDIGWWDTLRLR
LRMKRLQLERVLAQLASLAGTDALQRTVTQAIEAVSNQIESCPTTQDPDGVQAFAQALIT
RRQEAITDPAALLPQFDAVISTADEETRLALCVIRAGLVSHSMSLAHTHVRLNATQLHNV
ARQRLGITDPPEDQSRRRILLSKINEALDTVQPVNIDFGTLIAEQASAARLMMTVAQVVK
HIDSAAPVRFLIAETESGYTLLTALWLARLLGIEDRIEISPLFETADALEQGARILQEAL
RSPHYRAYLQKTGRLALQFGYSDSGRYVGQLAASYLIERLRMKIAELLARYDVKGVEVIL
FDTHGESIGRGAHPGSLYDRLKYLSPTKSRKALRAAGVVVREESAFQGGDGYLLFGTPAL
ATATIARIAEHAFPRMSGPKDPVYDEQDFASDYFTTIRTHMEELVEDPGYAALLGAFGPA
LIDKTGSRPAARQSDGAVGRPQISHPRELRAIPNNAILQQLGWCANSIHGIGAALIRHPE
TFDDLYQNSFRFRRAMNLAEHALRHSDLDVLRAVVATFDPTTWLDRAAHERETDQRKTKA
LMLVAKAVERLGLAAVTQAMFRRIQVDHLQLRAGWSDAPRMTMRERLLHALRLALIHRIW
LLETEIPDFSPRHGVTRQALEALILRLEIPLALNLLSQVFPPAPDPAVERDYFEPSTERQ
GSSYAHEHATIFQPMSDMFDLVREIGTAISHEVGAFG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaaaattccggtgatggcagacatgcacgacacgcaggcacctgcggacctggcc
gccgaattgctttcggtcacagaacgctctgttgagcgctctaccgaagatcccttcggc
aatccgatgctttcagtggcgcttgcgattgcgcgccgaatcgaaagcggatcattaagt
cacgcctctctcgtggcgctggtaaagcatctgagagatgccgcctatctcgaccgcgca
cgaaggcttgccaattatgttggtggcatcgaaggggctgacgaggcgctcgctcacgtg
gcccggcgtgtggtcaggcctgatcccaatgacagcccgatttctttccgcgattttcag
cctgaggttgagcgaacccgctttgccgccgtctttacggctcatccgacgttctcaatg
ccagctgaggttggtcacgcgctggcagaagcagccggtggcgctgaagtatcttctttc
gaatcgcatcgtcccccttctgtaactctggaagacgagttcgatcaggcagtggctgcc
attatcaatggccgtgatgccatcgatcagttgaaccgcaacctgctggtggccgcccgt
gatgtctggccggatcgctggagcgatctgacgccaaggccggttattctgaccagctgg
gttggctacgatacggatggtcgtaccgatattggctggtgggacacgttacgcctgcgg
ctgcgtatgaagcgcctccaactggagcgcgttctggcacaattggcctcgctcgcggga
accgatgcgcttcagcggacagtgactcaggcgattgaggccgtttcgaaccagatcgaa
tcttgcccgacgacacaggatcccgatggcgtgcaggcttttgctcaggcgctcatcaca
cgtcggcaggaagcgatcactgatcctgctgccctgctgccgcaattcgatgcggtgatc
agcacggcagatgaggagacgagactggcactgtgcgtgatccgtgcaggcctggtgtcg
cattccatgtctctggctcatacgcatgtgcgtctgaatgcgacccagctgcataatgtt
gcccggcagcgtctgggcattacagatccgccggaagatcagtcccgccgtcgtattctg
ctgagcaagatcaacgaggcgctcgatactgttcagcccgttaatatcgattttggtacg
ctgattgccgagcaggcttcggcggcccggttgatgatgacggtggcgcaggttgtcaaa
cacatcgacagtgcagcaccagtcagattcctgatcgccgagaccgaaagcggttacacg
ctgttgactgcgctgtggctggcaaggcttctggggatcgaggaccggatcgagatttct
ccgctgttcgagaccgccgatgcgttggaacagggcgctcgaatcctgcaggaagcgctg
cgcagcccgcattaccgcgcctatctgcaaaagaccggtcgtcttgcacttcagttcggt
tattcggattccggtcgttatgtcggacagctggccgccagctatctgatcgaacgcctg
cgtatgaaaattgccgagctgctggcccgttatgacgttaagggtgtcgaggtcattctg
ttcgatacgcatggcgaaagcatcggacgtggtgcgcatcccggctcgctctatgatcgc
ctgaaatatctttcgcccaccaaaagccgcaaggcccttcgtgctgcaggcgttgtggtg
cgtgaggaaagtgcttttcaaggcggtgatggctatctgttgttcggcactccggcgctg
gcaacggccacgattgcccggattgcggaacatgctttcccacgtatgtcaggcccgaaa
gatcccgtttatgatgagcaggattttgcctcggattacttcacgaccatccgtacgcat
atggaagagctggtggaagatccgggctatgccgctctgttgggtgcgttcggcccggct
ctgatcgacaagaccggctcccgcccggccgcccgccagagcgatggagccgtggggcgt
ccgcagattagccatccgcgcgaattgcgggccatccccaataacgccatccttcagcag
ttgggctggtgtgccaattccattcacggcattggcgcggccttgatccgtcatcctgaa
acgttcgacgatctttatcagaacagcttccgtttccgccgggccatgaatctggccgag
catgcgttgcgccattctgatctggacgtattgcgtgccgtggtggcgacattcgacccc
accacctggctggatcgtgcagcgcatgagcgagaaaccgatcagcggaagacaaaggcg
ctgatgctggtagccaaggcggtggagcggctggggctggcggcggtgacacaggcgatg
ttccggcgcattcaggtggatcacctgcaactgcgtgctggctggtctgatgcaccgcgc
atgaccatgcgtgagcgcctgctgcatgcgctgaggctggcgttgattcatcgtatctgg
cttctggagacggaaattcctgatttctcgcctcgtcatggagtaacccgtcaggctctg
gaagccctgattttgcggctggaaattcctctcgccctcaatcttctgagtcaggtattc
ccgcctgcgccagacccggcggtggaacgggattatttcgaaccatcaactgaacgccag
ggcagcagctatgctcatgagcatgccactattttccagccgatgagcgatatgtttgat
ctggtgcgggagatcggcacggccattagccatgaggtgggcgcttttggataa

DBGET integrated database retrieval system