KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0225Help
Entry
GbCGDNIH2_0225    CDS       T03083                                 

Definition
(GenBank) Enoyl-[acyl-carrier protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00061  Fatty acid biosynthesis
gbh00780  Biotin metabolism
gbh01100  Metabolic pathways
gbh01130  Biosynthesis of antibiotics
gbh01212  Fatty acid metabolism
Module
gbh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GbCGDNIH2_0225
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GbCGDNIH2_0225
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GbCGDNIH2_0225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gbh01004]
    GbCGDNIH2_0225
Enzymes [BR:gbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GbCGDNIH2_0225
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GbCGDNIH2_0225
Lipid biosynthesis proteins [BR:gbh01004]
 Fatty acid synthase
  Component type
   GbCGDNIH2_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AHJ67219
UniProt: W6HZ59
LinkDB All DBs
Position
complement(264768..265601)
Genome map
AA seq 277 aa AA seqDB search
MTQSGPRTGTLMQGKRGLIMGVANDRSIAWAIAQACAAQGAQLAFTYQGDALAKRVIPLA
ESVGSSLIVPCDVGDDASMDQAFDQVSDHFGGKLDFLVHAIGWADKNFLRGRYLDIPRDA
FLQALDISCYSFTAVCRRAAELMGDGGSMLTLSYLGAERWMPHYNVMGVAKAALEASVRY
MAADLGGNGIRVNSLSAGPIKTLAASGIGDFRYILRWNELNAPMARNVTLAEVGSAGLYL
VSDLSSGVTGENHHVDCGYHIVGMKNPLAPDIAVVSD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacacagagcggaccccggactggaactttgatgcaggggaaacgcggtcttatcatg
ggtgtcgccaatgaccgctccattgcctgggccatcgcgcaagcctgtgccgcacagggg
gcgcaactcgccttcacctatcagggggatgctttggccaagcgggtcattccgcttgcg
gaaagtgttggcagctctctgatcgttccatgtgatgttggtgatgatgcctcgatggat
caggcgtttgaccaggtttccgatcatttcggcggcaaactggatttcctggtccatgct
attggctgggcggacaagaattttctgcgcggccggtacctggatattccgcgcgatgca
tttctgcaggcgctggacatctcatgctacagcttcaccgctgtctgtcgccgtgcggca
gagctgatgggcgatggtggctccatgctgacgctgagctatctgggggcggagcgctgg
atgccgcattataacgtcatgggcgtggccaaggcagcactggaagccagcgtgcgttac
atggccgccgatctgggcgggaatggcatccgggtgaacagcctgtctgccgggccgatc
aaaacactggccgccagtggaatcggcgatttccgctatatcctgcgctggaacgaactg
aacgcgccgatggcccgcaatgttactctggccgaagtcggcagtgccggtctgtatctg
gtgtctgatctcagcagcggcgtgaccggcgaaaaccaccatgtcgattgcggttatcac
attgtcggcatgaaaaatcctctcgcccccgacattgcggtggtttcagactga

DBGET integrated database retrieval system