KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0426Help
Entry
GbCGDNIH2_0426    CDS       T03083                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00473  D-Alanine metabolism
gbh00550  Peptidoglycan biosynthesis
gbh01100  Metabolic pathways
gbh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GbCGDNIH2_0426
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GbCGDNIH2_0426
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GbCGDNIH2_0426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gbh01011]
    GbCGDNIH2_0426
Enzymes [BR:gbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GbCGDNIH2_0426
Peptidoglycan biosynthesis and degradation proteins [BR:gbh01011]
 Precursor biosynthesis
  Amino acid ligase
   GbCGDNIH2_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATPgrasp_Ter Nif11
Motif
Other DBs
NCBI-ProteinID: AHJ67441
LinkDB All DBs
Position
complement(484164..485156)
Genome map
AA seq 330 aa AA seqDB search
MWHDPPLGNQTDRNSVPSSGVSVMSIRRVVVLYGGISEERAVSLISGQQVVAALREAGYE
VTPIEVGADLRDTIAALTPAPDVVFNALHGRFGEDGAIQGVLDWLNIPYTHSGVRASAIA
MDKAAARTAFLAAGLPVAEGRLVTVEELAEQDPLPRPFVIKPANEGSAVGVHILHEGDNR
RTEIARSWSFGGQALVEEYIPGRELTVGVLNDRALTVTDIRPRSAFYDYESKYAEGGSRH
ILPAQMHPDAFKRALDVALAAHHALGCRGATRSDFRYDDTRAEPGRLVLLEVNTQPGLTP
TSLLPEQAALMGMDFVSLCRWMVEQATCRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgtggcacgaccctccattgggaaatcaaacggatcggaattccgttccatcatccgga
gtgtcagtcatgagcatcagacgcgttgtggtcctgtatggcggcatctccgaagaacgg
gccgtcagcctcatctccggtcaacaggtcgtcgccgccctgcgtgaagcaggctatgag
gtcaccccgatcgaagtcggggctgatctgcgcgataccatcgccgccctgacgcccgcg
ccggatgtcgtgttcaacgcgctccatggccgtttcggcgaggatggcgccattcagggt
gtgctcgactggctcaacattccctatacccattccggggttcgcgcttccgccattgcg
atggacaaggccgccgcacgcaccgcctttctggccgctggtctaccggttgccgaaggc
aggctggtcacggtggaggaactggcggaacaggatccgcttccacgccccttcgtgatc
aagccggccaatgaaggctcggcggtgggcgtgcatatcctgcatgaaggcgataaccgg
cgcacggaaattgcccgcagctggagcttcggcggacaggcgctggtcgaggaatatatc
cccggccgcgaactgaccgtgggtgtgctgaatgatcgcgccctgacggtcacggatatc
aggccgcgctccgccttctatgactatgaatccaaatatgctgaaggtggctcccgccat
atcctgcccgcccagatgcacccggatgcattcaagcgggcgctggatgtggctctggcc
gcgcatcatgcgctgggatgccggggcgcgacccgttcggatttccgctatgacgataca
cgcgccgagccggggcggctggtgctgctggaggtcaacacccagccaggtctgacgccg
acctccctgctgccggaacaggcagccctgatggggatggacttcgtctccctgtgccga
tggatggtggagcaggcaacatgtcgcgcgtga

DBGET integrated database retrieval system