KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0552Help
Entry
GbCGDNIH2_0552    CDS       T03083                                 

Definition
(GenBank) Protein translation elongation factor Tu (EF-TU)
  KO
K02358  elongation factor Tu
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gbh03012]
    GbCGDNIH2_0552
   03029 Mitochondrial biogenesis [BR:gbh03029]
    GbCGDNIH2_0552
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbh04147]
    GbCGDNIH2_0552
Translation factors [BR:gbh03012]
 Eukaryotic Type
  Elongation factors
   GbCGDNIH2_0552
 Prokaryotic Type
   GbCGDNIH2_0552
Mitochondrial biogenesis [BR:gbh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GbCGDNIH2_0552
Exosome [BR:gbh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GbCGDNIH2_0552
  Exosomal proteins of breast cancer cells
   GbCGDNIH2_0552
  Exosomal proteins of colorectal cancer cells
   GbCGDNIH2_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AHJ67580
UniProt: A0A1L3RNX7
LinkDB All DBs
Position
637680..638870
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEERARG
ITISTAHVEYETGNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLDLVEMEVRELLSSYQFPGDDIPIIKGSALCALE
DKNPEIGRDAILKLMEAVDAYIPQPERPLDRPFLMPIEDVFSISGRGTVVTGRIERGEVK
VGDEVEIVGLKATSKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTKFAAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVSLPEGTEMVMPGDNVS
MQVELIAPIAMDEGLRFAIREGGRTVGAGVVAKISQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgaaatttgagcggaacaaaccgcactgcaacatcggcacgatcggacat
gttgatcatggcaagacgtcgctgacagcagctatcacgaaggtgcttgccgaaaccggc
ggcgcaactttcaccgcgtatgaccagatcgacaaggcgccggaagaacgcgcccgtggt
atcacgatttccacggcgcacgtggaatatgaaaccggcaaccgtcactacgcgcacgtg
gattgccccggtcacgccgactatgtgaagaacatgatcaccggcgcggcccagatggat
ggcggcattctcgtcgtctccgctgctgacggtccgatgccgcagacccgtgagcacatt
ctgctcgcccgtcaggttggcgttccggccctggtcgtgttcctgaacaaggtcgacatg
gtcgacgatccggagctgctggatctggtcgaaatggaagtgcgcgagctgctttcttcc
taccagttcccgggcgacgatattccgatcatcaagggttccgctctgtgcgcccttgaa
gacaagaacccggaaatcggccgtgatgcgatcctgaagctgatggaagcggtggatgcc
tacatcccgcagccggagcgtccgctggaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctccggccgtggcaccgtggtgaccggtcgtatcgagcgcggtgaagtcaag
gttggtgacgaagtcgaaatcgtcggcctgaaggcgacctccaagacgaccgtgaccggc
gttgaaatgttccgcaagctgctcgatcgcggtgaagctggcgacaacatcggtgcgctg
ctgcgtggcaccaagcgtgaagacgtcgagcgtggtcaggttctggccaagccgggctcc
atcaccccgcatacgaagttcgccgctgaggcgtacatcctcacgaaagaagagggtggc
cgtcatacgccgttcttcaccaattaccgtccgcagttctacttccgcacgaccgacgtc
actggcgttgtgagcctgccggaaggcacggaaatggtgatgccgggcgacaacgtgtcc
atgcaggttgagctgattgcgccgatcgcgatggatgaaggtctgcgttttgctattcgt
gaaggcggccgcaccgttggtgcaggcgtcgtcgcgaagatttcgcagtaa

DBGET integrated database retrieval system