KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0904Help
Entry
GbCGDNIH2_0904    CDS       T03083                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh03030  DNA replication
gbh03410  Base excision repair
gbh03420  Nucleotide excision repair
gbh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GbCGDNIH2_0904
   03410 Base excision repair
    GbCGDNIH2_0904
   03420 Nucleotide excision repair
    GbCGDNIH2_0904
   03430 Mismatch repair
    GbCGDNIH2_0904
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gbh03032]
    GbCGDNIH2_0904
   03400 DNA repair and recombination proteins [BR:gbh03400]
    GbCGDNIH2_0904
Enzymes [BR:gbh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GbCGDNIH2_0904
    6.5.1.6  DNA ligase (ATP or NAD+)
     GbCGDNIH2_0904
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GbCGDNIH2_0904
DNA replication proteins [BR:gbh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GbCGDNIH2_0904
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GbCGDNIH2_0904
DNA repair and recombination proteins [BR:gbh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GbCGDNIH2_0904
   NER (nucleotide excision repair)
    Other NER factors
     GbCGDNIH2_0904
   MMR (mismatch exicision repair)
    Other MMR factors
     GbCGDNIH2_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase Cas9-BH DNA_ligase_A_N 2_5_RNA_ligase2
Motif
Other DBs
NCBI-ProteinID: AHJ69371
LinkDB All DBs
Position
1038587..1040182
Genome map
AA seq 531 aa AA seqDB search
MIAFAALLERLIYTPSRNARLALLQRFFETEPDPDRGYGLAALTGNLSFATAKPGLIRAL
AGQRVDPELFALSYDYVGDLAETTSLIWPVSVDILPMAPPGLAEVVTTLQSATRIDLPQT
LSAWLDSSDESVRFAILKLVTGNLRVGVSARLAKVALAGLSQGRIEPDEIEEVWHGLTPP
YLTLFAWIEGHGPRPDPAGAPVFRPPMLAHPLEQPDLETLSLSEYRVEWKWDGIRVQLVS
VPGGKRIFSRTGDDISASFPDVLETMNFDGVLDGELLVAREGEVAPFADLQQRLNRKSPG
PASLKQHPAHVRLYDILFDEQERDLRALSFDERRQHLERWFAVAAPLRMDLSGLIKVENA
EALIALREGARAASIEGLMLKRGDSPYVPGRPRGLWWKWKRNPLTVDAVIMYAQRGHGRR
SSFYSDYTFGLWRDDGRGHEELVPVGKAYHGFTDQELIVLDRWVRNHTIARFGPVREVEK
SFVLEIAFDAVQRSGRHKSGIAMRFPRIARLRTDKPASEADRLETLERMLT
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttttgccgccctgctggagcgtctgatctatacgccgtcgcgcaatgccagg
ctggctctgctgcaacgttttttcgaaaccgaacctgatccggatcgcggatacgggttg
gcggcgctgacaggtaacctgtcttttgccacggcgaaaccgggcctgattcgcgcattg
gcagggcagcgtgtcgatcccgaattatttgccctgtcctatgattatgtcggtgatctg
gccgagacgacctccctgatctggccggtctctgttgatatccttccgatggcccctccc
ggattggcagaggtcgtgacgacccttcagagcgccaccagaatagacctgccgcagaca
ttatccgcatggctggactcgtcggatgaatcggtacggttcgcgattctcaagctcgtg
actggcaatcttcgggttggtgtctctgcaaggctggccaaagtggcattggccggattg
tcacaggggcggatcgagccggatgaaatagaggaggtgtggcacggtctgacacccccc
tatctgacgctgtttgcatggatcgaggggcatggtcccagaccggacccggccggtgcg
cccgtgttccgtcctcccatgctggcccatccgctggagcagcctgatctggagactctt
tccctctctgaataccgggtggagtggaaatgggatggtatccgggtgcaactcgtttcc
gtgccggggggaaagcgcattttctcccgcacgggcgatgatatctccgcttcctttccg
gatgtgctggagaccatgaatttcgacggcgtgctggatggagaactgctggttgcacgg
gaaggagaggtggctccgttcgctgatcttcagcagcgactcaaccgcaaatctcctggc
ccggcttcgttgaagcaacatccggctcatgtcaggctctatgatattctgttcgatgaa
caggagcgtgatctgcgggccctgtcctttgatgagcgcaggcagcatctcgagcgctgg
tttgccgttgcggccccgctccgcatggatctgtccggcctgatcaaggtggaaaatgca
gaggccctcattgccttgcgggagggcgcgcgtgcggcttcgatcgaagggctgatgctc
aagcgtggtgacagtccctacgtgcccgggcggcccagaggcttgtggtggaagtggaaa
cgtaatccgctgacggttgatgcggtgatcatgtatgcgcagcgtggccatggcaggcgc
agcagtttctattccgattatacgttcggcttatggcgcgatgacggtcgtgggcatgag
gagttggtacctgtcggcaaggcctatcacggctttacggatcaggagctgattgtgctg
gatcgctgggtgcgcaaccacactatcgcccggttcggcccggtgcgggaggtcgagaaa
tctttcgtgctggaaatcgcttttgatgcagtgcaaaggtcgggccgtcacaaaagcggt
attgccatgcgcttccccagaatagcgaggctgcggactgataaaccggcgtcagaggct
gacaggcttgagaccctggagcgtatgctcacctga

DBGET integrated database retrieval system