KEGG   Immundisolibacter cernigliae: PG2T_01235Help
Entry
PG2T_01235        CDS       T04454                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00621  Dioxin degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Module
gbi_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG2T_01235
Enzymes [BR:gbi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     PG2T_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9 FSH1 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: ANX02948
UniProt: A0A1B1YQ98
LinkDB All DBs
Position
complement(252999..253823)
Genome map
AA seq 274 aa AA seqDB search
MNAAQYEKKYIDVNGIKTCYIEQGSGEPLILIHGGGAGANGYGNWFGCLPLFGEHFRTIA
VDMVGFGNSDSPDPATFEYSQKNRYDHIAGFIKALGYDKASLVGNSMGGATAMGVAVEYP
QLVDKLVLMGTAGLNGEITPALQPVLGYDYTPEGMIRLIKTLANDKFVITDEMVQYRWNN
SVDPTNKTSYDATMQWVRKQGGLFYPEEFIARVTQPTLVVNGKDDLVVPLSHAYRFLELI
DNSWGYIVPHCGHWAMIEYPADFAAAVTSFVKSH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcgcagtacgaaaagaaatacatcgatgtcaacggcatcaagacctgttac
atcgaacagggcagcggcgagccgctgatcctgatccacggcgggggcgccggcgccaac
ggctacggcaactggttcggctgcctgccgctgtttggcgagcactttcgcaccatcgcc
gtggacatggtcggcttcggcaactccgacagccccgaccccgccaccttcgagtattcg
cagaagaaccgctacgaccacatcgccggcttcatcaaggcgctcggctacgacaaggcg
agcctggtcggcaactccatgggcggcgccaccgccatgggcgtggcggtcgagtacccg
cagctggtcgacaagctggtgctcatgggcaccgccggcctgaatggcgagatcaccccg
gccctgcagccggtgctcggctacgactacacgcccgagggcatgatccggctgatcaag
accctggccaacgataagttcgtcatcaccgacgagatggtccagtaccgctggaacaac
tcggtcgaccccacgaacaagacctcctacgacgccaccatgcagtgggtgcgcaagcag
ggcggcctgttctatccggaagagttcatcgcccgcgtcactcagccgaccctggtggtc
aacggcaaggacgacctggtggtgccgctcagccatgcctaccgcttcctggagctgatc
gacaactcctggggctacatcgtgccgcactgcggccactgggcaatgatcgagtacccg
gcagatttcgccgcggcggtcaccagcttcgtcaagtcgcactga

DBGET integrated database retrieval system