KEGG   Immundisolibacter cernigliae: PG2T_01265
Entry
PG2T_01265        CDS       T04454                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00621  Dioxin degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Module
gbi_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG2T_01265
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     PG2T_01265
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: ANX02954
UniProt: A0A1B1YQA8
LinkDB
Position
complement(258038..259201)
AA seq 387 aa
MNTPTVPLVDPQVLDRIRGWRGYAEAKLGFRNHWYPTLNSSEVAEGQPVPFQLGGEKLLI
NRIDGKLYCIKDQCLHRGVPLSRKLECYSKDTISCWYHGWTYQWADGKLCDILTDPSSKM
IGTRSLKTYPAQELKGLVFVFLGDIEPTPLARDLPPGFDEADRRVQPFRRVVNANWRIGA
ENGFDTTHIFIHKDSRLIRGNQTMLPLGFAPNPNSKEPLFETRHTEGGNIGVFDLLAERG
VPHFEGSVHGEVVRRAIHGGDKHIAGQISLWMPGVLKVDPFPDPAMIHFEWYVPRDADSH
WYIHCATKVVEGPNADAEFAEEYEALWKDLYAHGFNDDDIWAREATQPFYQDDWGWLKEQ
LFEADACIMAWRKLASEHNRGIQTAGR
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaacacacctactgtccccctggtcgacccccaagtcctggaccgcatccgcggctgg
cgcggctatgccgaggccaagctcggctttcgcaatcactggtacccgaccctgaacagc
agcgaggtagccgagggccagccggtgccgttccagctgggcggcgagaagctgctgatc
aaccgcatcgacggcaagctgtactgcatcaaggaccagtgcctgcaccgcggcgtgccg
ctgtcgcgcaaactcgagtgctacagcaaggacaccatctcgtgctggtaccacggctgg
acctaccagtgggccgacggaaagctgtgcgacatcctgactgatccgtcgagcaagatg
atcggcacccgctcgctgaagacctacccggcgcaggagctcaagggtctggtgttcgtg
tttttgggcgacatcgagccgacgccgctggcacgcgacctgccgcccggtttcgacgag
gcggaccggcgcgtgcagccatttcgccgcgtggtaaacgccaactggcgcatcggcgcc
gaaaacggcttcgacaccacgcacatcttcatccacaaggactcgcgcctgatccgcggc
aaccagaccatgctgccgctgggtttcgcgcccaatccgaacagcaaggagccgctgttc
gagacgcgccacaccgagggcggcaacatcggcgtgtttgacctgctggccgagcgcggc
gtgccgcacttcgagggcagcgtgcacggcgaggtggtgcgccgcgccatccacggcggc
gacaagcacatcgccggccagatttcgctgtggatgcctggcgtgctcaaggtcgacccg
ttcccggacccggcgatgatccacttcgagtggtacgtgccgcgcgatgccgacagccac
tggtacatccactgcgccaccaaggtggtcgagggtccgaatgccgacgccgagttcgcc
gaggaatacgaggcgctgtggaaggacctgtacgcgcacggcttcaacgatgacgacatc
tgggcccgcgaagccacgcaaccgttctaccaggacgactggggctggctgaaggagcag
ctgttcgaggccgacgcctgcatcatggcgtggcgcaagctggccagcgagcacaaccgc
ggcatccagaccgccggccgctga

DBGET integrated database retrieval system