KEGG   Immundisolibacter cernigliae: PG2T_02985
Entry
PG2T_02985        CDS       T04454                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00362  Benzoate degradation
gbi00622  Xylene degradation
gbi00643  Styrene degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Module
gbi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PG2T_02985
   00622 Xylene degradation
    PG2T_02985
   00643 Styrene degradation
    PG2T_02985
Enzymes [BR:gbi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     PG2T_02985
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Esterase Abhydrolase_4 Peptidase_S15 tRNA_edit FSH1
Other DBs
NCBI-ProteinID: ANX03256
UniProt: A0A1B1YR46
LinkDB
Position
complement(631771..632616)
AA seq 281 aa
MSTSVVEKKIPSGAIASHVLLAGDPKNPPAILLHGAGPGATAASNWLRCAPDLAKHYYVI
APDLVGFGQTELPAELPTHILGWIGHRVEQVLGLMDTLGVERAHVVGNSMGGALTLHALV
QAPQRFDKVLLMGAIGAPFEYSWEMKRLLEFYKDPRPARYKEVIESFVHDPAAVPGLDEI
IKQRYAVAMDPKTREMTNLLFQAQAAGMNDLTVPEAQLGRLPHPVLLVHGRQDRIVPLDT
SLYFLKHLQQAELVVLDRCGHWAQTQRWDAMYPLIVKHFGG
NT seq 846 nt   +upstreamnt  +downstreamnt
gtgagtacatccgtcgtcgaaaaaaagatcccgtccggcgccatcgccagccacgtgctg
ctggccggtgaccccaagaatccgccggccatcctgctgcacggcgccggtcccggcgcc
acggcggcctccaactggctgcgctgcgcgccggacctggccaagcattactacgtgatc
gccccggacctggtcggctttggccagaccgagctgccggccgagctgccgacccacatt
ctgggctggatcgggcaccgcgtggagcaggtgctggggctgatggacacgctgggcgtc
gagcgcgcccacgtggtcggcaattccatgggtggcgccctgaccctgcacgcgctggtg
caggcgccgcagcgcttcgacaaggtgctgctgatgggagccatcggcgcgccgttcgaa
tacagctgggaaatgaagcgcctgctggagttctacaaggatccacggccggcccgctac
aaggaagtgatcgagagcttcgtgcatgatccggccgccgtgccgggcctggacgagatc
atcaagcagcgctacgcggtggccatggaccccaagacgcgcgagatgaccaacctgctg
ttccaggcgcaggccgccggcatgaacgacctgaccgtgccggaagcccagctcgggcgc
ctgccgcacccggtgctgctggtgcacggccgccaggatcgcatcgtgccgctggacacc
agcctgtacttcctgaagcacctgcagcaggccgagctggtggtgctggaccgctgcggc
cactgggcgcagacccagcgctgggacgccatgtacccgctgatcgtcaagcacttcggc
ggctga

DBGET integrated database retrieval system