KEGG   Immundisolibacter cernigliae: PG2T_07695Help
Entry
PG2T_07695        CDS       T04454                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00061  Fatty acid biosynthesis
gbi01100  Metabolic pathways
gbi01212  Fatty acid metabolism
Module
gbi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PG2T_07695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gbi01004]
    PG2T_07695
Enzymes [BR:gbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PG2T_07695
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PG2T_07695
Lipid biosynthesis proteins [BR:gbi01004]
 Fatty acid synthase
  Component type
   PG2T_07695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ANX04075
UniProt: A0A1B1YTH9
LinkDB All DBs
Position
complement(1612105..1612680)
Genome map
AA seq 191 aa AA seqDB search
MPLQTHATEDTVTETSAVAQRVDSFSHDQLLRCARGELFGPGNAQLPLPPMLMFDRITHI
SDHGGQFGRGEIRAELDVRPDLWFFGCHFEGDPVMPGCLGLDAMWQLVGFYLGWIGGPGR
GRALGADEVKFGGEVTPAARLVSYHIHMKRVIQRKLFMGIADATVAVDGNPIYTASGLRV
GLFTNTFESAP
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcccttacagacccatgccacggaagacactgtgaccgaaacatccgccgtcgcgcag
cgcgtggactccttcagccatgaccagctgctgcgctgcgcgcgcggcgagctgttcggc
cccggcaacgcgcagctaccgctgccgcccatgctgatgttcgaccgcatcacgcacatc
agcgaccacggcggccagttcggccgcggcgaaattcgcgccgaactggacgtgcggccg
gacctgtggtttttcggctgtcatttcgagggcgatccggtcatgcccggctgcctgggc
ctggacgccatgtggcagctggtcggcttttatctgggctggatcggcggcccgggtcgc
gggcgggcgctgggcgccgacgaagtgaagttcggcggcgaagtcacgccggccgcgcgc
ctggtcagctaccacatccacatgaagcgcgtgatccagcgcaagctgttcatgggcatc
gccgatgccaccgtggcggtcgacggcaaccccatctataccgccagcggcctgcgggtg
ggcctgttcaccaacaccttcgagagcgcaccgtga

DBGET integrated database retrieval system