KEGG   Immundisolibacter cernigliae: PG2T_11135Help
Entry
PG2T_11135        CDS       T04454                                 

Definition
(GenBank) hypothetical protein
Organism
gbi  Immundisolibacter cernigliae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Smr YbjN
Motif
Other DBs
NCBI-ProteinID: ANX04663
UniProt: A0A1B1YVJ6
LinkDB All DBs
Position
complement(2335980..2336513)
Genome map
AA seq 177 aa AA seqDB search
MGSKTDPPDAPDPGAEFRAAVGPVRPLRGAPPAKVPPAARPVTPPGRRPQAPPPLPAVLP
VIEPGATVRLARPGVPKRALRRLDGELFVAEAQLDLHGLTAAQAGAALQAFIADCLAAGC
ERVRIIHGKGQRPGQDLPVLKPLVIESLKGHPAVLALRSAGPRDGGSGAMRVLLRRA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgaaaactgatccacccgacgcgcccgatccgggcgccgagtttcgcgccgcg
gtcgggccggtgcggccgctgcgcggggcgccgcccgccaaggtgccgccggcagcgcgc
ccggtcaccccacccggcaggcgaccgcaggccccaccaccgttgccggccgtgttgccg
gtcatcgagcccggagcaaccgtgcggctggctcggcctggcgtgccaaagcgtgcgctg
cgccgcctggacggcgagctgttcgtggccgaggcgcagctcgacctgcacggcctgacg
gcggcacaggctggtgctgcgttacaggcgttcatcgccgactgcctggcggccggctgc
gagcgcgtgcgcatcattcacggcaagggccagcgtccgggccaggatctgccggtgctc
aagccgctggtgatcgagtcgttaaaagggcatcccgcggtgcttgcgctacgcagcgca
ggtccccgcgacggtggcagtggcgccatgcgcgtgctgctgcgccgtgcctga

DBGET integrated database retrieval system