KEGG   Immundisolibacter cernigliae: PG2T_13255Help
Entry
PG2T_13255        CDS       T04454                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00020  Citrate cycle (TCA cycle)
gbi00270  Cysteine and methionine metabolism
gbi00620  Pyruvate metabolism
gbi00630  Glyoxylate and dicarboxylate metabolism
gbi00680  Methane metabolism
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
gbi01120  Microbial metabolism in diverse environments
gbi01130  Biosynthesis of antibiotics
gbi01200  Carbon metabolism
Module
gbi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gbi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PG2T_13255
   00620 Pyruvate metabolism
    PG2T_13255
   00630 Glyoxylate and dicarboxylate metabolism
    PG2T_13255
  09102 Energy metabolism
   00680 Methane metabolism
    PG2T_13255
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PG2T_13255
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     PG2T_13255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ANX05046
UniProt: A0A1B1YWB8
LinkDB All DBs
Position
2791901..2792878
Genome map
AA seq 325 aa AA seqDB search
MNKPVRIAVTGCAGNIGYALLFRIAAGDMLGPDQPVILHLLEVTPALKALEGVSMELRDC
AFPLLADIVATDDPAVGFKDADYAILVGARPRGPGMERKDLLEANGAIFTVQGKALNDHA
SRGVKVLVVGNPANTNALIAMRSAPDLDPRQFTAMMRLDHNRAISQLAAKTGSTVPAIRR
MTVWGNHSSTQYPDISHTLVDGRPAPELVDQAWLETDFIPTVQQRGAAIIAARGASSAAS
AASAAIDHMRTWALGTADGDWVSMGIPSDGSYGIPEGIIYSYPVTCRDGRYEIVQNLPVS
AFSRARMDATARELLEEREAVQHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagcccgtccgcatcgctgtcaccggctgcgccggcaatatcggctacgcactg
ctgttccgcatcgccgccggcgacatgctcggccccgaccagccggtcatcctgcacctg
ctggaagtcacgccggccctgaaggcgctcgaaggcgtgagcatggaactgcgcgactgc
gcgttcccgctgctggccgatatcgtggccaccgacgatccggcggtcggcttcaaggat
gccgactacgccatcctggtcggtgcccgcccgcgcggtccgggcatggagcgcaaggac
ctgctggaggccaacggcgccatcttcaccgtgcagggcaaggcgctgaacgaccacgcc
agccgcggcgtgaaggtgctggtggtcggcaacccggccaacaccaacgccctgatcgcc
atgcgcagcgcaccggacctggacccgcgccagttcacggccatgatgcgcctggaccac
aaccgtgccatcagccagctggctgccaaaaccggctcgacggtgccggccatccgccgc
atgaccgtgtggggtaaccactcttccacgcagtacccggatatttcgcacacgctggtc
gatggccgtccggcgccggaactggtcgatcaggcctggcttgagaccgacttcatcccc
accgtgcagcagcgcggcgccgccatcatcgccgcccgcggcgcgtcgagcgccgcctcg
gcggcgtcggcagccatcgatcacatgcgcacctgggcgctgggcaccgccgacggcgac
tgggtcagcatgggcattcccagcgacggcagctacggcatcccggagggcatcatctat
tcctatccggtgacctgccgcgacgggcgctacgagatcgtgcagaacctccccgtcagc
gccttcagccgcgcccgcatggatgccaccgcccgggagctgctggaagaacgtgaggcc
gtccagcacctgctgtga

DBGET integrated database retrieval system