KEGG   Immundisolibacter cernigliae: PG2T_13530Help
Entry
PG2T_13530        CDS       T04454                                 

Definition
(GenBank) hypothetical protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00627  Aminobenzoate degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PG2T_13530
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     PG2T_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: ANX05097
UniProt: A0A1B1YWQ1
LinkDB All DBs
Position
complement(2856140..2857405)
Genome map
AA seq 421 aa AA seqDB search
MNAIQRPPMPAVDWPGQQDSVTRVPGRVFVDADIYALEQERIFRGPVWNFVGLDVEIPNP
GDYKTVQVADTPVIVSRDRDGSIHAWLNRCAHRNAKICLDKLGHTDSFYCVYHQWGYDLT
GRLIAVPFQRGIGGQGGMPADFDMDAIRPKKLRVENFCGVLFVSFSDETPPFEDYVGPHV
AKFMRRVFNRPIKILGHQHQHMRGNWKLYAENPRDGYHASLLHLFFATFGLFRASQKGQL
HVTESGLQTCFYTYVGKEDEAARQQGMQEAAHTYQEGTYKLEDGSLLKGKMEWDDGINLV
IIDVFPIMMLQQIANVLNIRQFEPHGPDGVTVHYTFFGYADEDQELTDMRLKQINLIGPA
GLVSMEDGLAIEIVQQGIASDGGTEAIIEMGGKTVAPDTTFMASEDPVRGFWNGYRRLMD
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatccagcgtccgccaatgcccgccgtagactggcccggccagcaggacagc
gtgacccgcgtgccgggccgggtattcgtggacgccgacatctacgctctcgaacaggaa
cgcatcttccgcggaccggtgtggaacttcgtcggcctggacgtggaaatccccaacccc
ggcgactacaagacggtgcaggtcgccgacacgccggtcatcgtcagccgtgaccgcgac
ggcagcatccacgcctggctgaaccgctgtgcgcaccgcaacgccaagatttgcctggac
aaactcggccatacggacagcttttactgtgtctatcaccagtggggctacgatctgacc
ggccgcctgatcgcggtgccgttccagcgcggcatcggcggccagggcggcatgccggcc
gatttcgacatggacgccatccggcctaaaaaactgcgggtcgagaacttctgcggcgtg
ctgttcgtcagcttcagcgacgagacgccgccgttcgaggactacgtcgggccgcacgtc
gccaagttcatgcgccgcgtcttcaaccggccaatcaagattctcggccaccagcaccag
cacatgcgcggcaactggaaactgtacgccgagaacccgcgcgacggctaccacgccagc
ctgctgcacctgttctttgccaccttcggcctgttccgggccagccagaagggccagctg
catgtcaccgaaagcggcctgcagacctgcttctacacctacgtcggcaaggaagacgaa
gcggcccgccagcagggcatgcaggaagccgcccacacctaccaggaaggcacctacaag
ctggaagacggcagtctgctcaagggcaaaatggaatgggacgacggcatcaacctggtc
atcatcgacgtgttcccgatcatgatgctgcagcagatcgccaacgttctgaacatccgc
cagttcgagccgcacgggccggacggcgtgaccgtgcactacaccttcttcggctatgcc
gacgaagaccaggaactgaccgacatgcgcctgaagcagatcaacctgatcggcccggcc
ggcctggtgtcgatggaggacggcctggccatcgagatcgtgcagcagggcatcgccagc
gacggcggcaccgaggccatcatcgagatgggcggcaagacggtggcgccggacaccacc
ttcatggccagcgaagacccggtgcgcggcttctggaacggctaccggcggctgatggat
atgtga

DBGET integrated database retrieval system