KEGG   Geobacter bemidjiensis: Gbem_2250Help
Entry
Gbem_2250         CDS       T00749                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 protein, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00020  Citrate cycle (TCA cycle)
gbm00620  Pyruvate metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
Module
gbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2250 (aceF)
   00020 Citrate cycle (TCA cycle)
    Gbem_2250 (aceF)
   00620 Pyruvate metabolism
    Gbem_2250 (aceF)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gbem_2250 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACH39262
UniProt: B5EEB7
LinkDB All DBs
Position
complement(2618398..2619840)
Genome map
AA seq 480 aa AA seqDB search
MNEIVMPKLSDTMTEGRLVSWKKRVGETVTRGEVIAEVETDKANMELEAYVSGELLEIRV
QTGDLVPVGTVIAVVGKAGEKGAGATQQSAPVPHVEPEPARPQEEAPAGPPAAPKPEPGG
GEPVSSAAEPPGAKGAKPGTAVDLVPPEGEKQAPAAPPWPGAEESQPAGEPKEPYRPESL
QEGAAPSAELATGAGREKAAPMVRRCARELGVDLAQVQGSGPEGRILLTDLKLQKKESAP
AGQAPQAAAEAAPAPQGEGPRPMSRLRSAVARTVTESWHNIPHFTVTVDVEMDEAEAVRR
QLKQGGMPVSVNDLIVKAVALALSQFPQLNASFTPEGLQFHSDINIAIAVGMSDGVLMPV
LSACQKRSLLDIAQEAKKLVERARSGSLSEQEMHGGTFSISNLGMFGVGSFSAIIYPSQS
GVLAVGTVSEVARVNSGVLNSTKVMKVTLSADHRVVDGAYAAQFLAGLKEILENPVRLLI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatcgtcatgccgaaactgtccgacaccatgaccgaggggaggctagtctcc
tggaagaagagagtaggggagacggtgacccgcggcgaggtgattgccgaggtcgagacc
gacaaggcgaacatggaactggaagcctacgtctcgggcgagttgcttgagataagggtg
cagactggggacctggtgccggtaggaacggtgatcgccgtcgtcggcaaggccggtgaa
aagggagctggcgctacgcagcagtcggcaccggtgccgcacgtggagcctgaaccggca
aggccgcaagaggaggctcccgccggacccccggccgcgccgaaaccagagccaggtggg
ggagagcctgtatcgtcagccgcagagccgcctggcgcgaaaggggcgaaacctggcacg
gccgtcgaccttgttccaccggaaggggaaaaacaggccccggccgcgcctccctggccc
ggcgctgaagagtcgcagcctgccggcgagccgaaagaaccgtaccgcccggagtctttg
caggagggggccgccccgagcgctgagcttgcaaccggagccgggcgggaaaaggctgca
cccatggtcagacgctgtgcccgtgagctgggggttgatctcgcccaggtacagggaagc
ggtcctgaagggcgcattctgctcaccgacctgaagttgcaaaagaaggaatctgcgccg
gctggtcaagctccccaggctgccgctgaagcggcgcccgcgcctcagggcgaggggccg
aggccgatgtcgcggctgcggagcgctgtcgccaggacggtgaccgaatcctggcataac
atcccgcacttcacagtcaccgtggatgtcgagatggacgaggctgaagcggtccggcgc
cagttgaagcaaggcggcatgccggtcagcgtcaacgatctcatcgtgaaagcggtggct
ctggcgctctcacagttcccgcagctgaacgcgagctttacgccggaagggctgcagttc
catagcgacatcaacatagcgatagcggtaggtatgtctgatggcgttctcatgccggtg
ctctcggcttgccagaagcgctcgttgctggatatcgcacaggaagcaaaaaagctcgtg
gaacgtgcccgctccggcagcctcagcgaacaggagatgcacggcgggaccttctccatt
tccaacctcggcatgtttggtgtcggtagtttcagcgccatcatctatccctcccagtcg
ggagtacttgccgtcgggaccgtctccgaagtcgccagggtaaattcaggcgtgctgaac
agcacaaaggtcatgaaggtcaccctttccgccgaccatcgtgtggttgacggcgcctat
gccgcacaatttctggccggattgaaggaaatcctggagaacccagtccggcttctcatc
tga

DBGET integrated database retrieval system