KEGG   Geobacter bemidjiensis: Gbem_2832Help
Entry
Gbem_2832         CDS       T00749                                 

Definition
(GenBank) short-chain acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00071  Fatty acid degradation
gbm00280  Valine, leucine and isoleucine degradation
gbm00410  beta-Alanine metabolism
gbm00640  Propanoate metabolism
gbm00650  Butanoate metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Gbem_2832
   00650 Butanoate metabolism
    Gbem_2832
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gbem_2832
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbem_2832
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gbem_2832
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Gbem_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-ProteinID: ACH39836
UniProt: B5EID4
LinkDB All DBs
Position
complement(3258607..3259746)
Genome map
AA seq 379 aa AA seqDB search
MNFELSQDHKVLKDSVRDFVVNEIKPLAMQIDEEHMIPDDLVRKMGEMGFLGSYLPEEYG
GAGLDMLSYAIVVEEVSKACGSSGVLISAHTSLACGPIYTFGTEEQKKKWLPDLNTGKVI
GCFLLTEPDAGSDAGAIATTYKRDGDHFVINGSKIFITNGGYKGTGVLFATSDKNLKHKG
VSAFIIDLQSPGVEILKNEKKLGIRGSYTTAFALDSVRIPVENLLGQEGQGFKIAMDTLN
GGRIGIASQALGIAEGAFDLALAYSKERKQFGHPICELQAIQFKLADMYAKIETSKLMTY
KAACLKDSKKNYTMESAMCKMLASEAATFVTKEAIQIHGGYGFIVDYEVERMYRDAKITE
IYEGTNEVQRVVVSKLLLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaactgagccaggaccacaaggtgttgaaggatagcgttcgggatttcgtg
gtgaacgagatcaagccgctcgccatgcagatcgacgaggagcatatgatccccgacgac
ctggtgcgcaagatgggggagatgggtttcctcggctcctacctgccggaagagtacggc
ggcgcggggctcgacatgctctcctacgccatcgtggtcgaggaggtctccaaggcctgc
ggttccagcggcgtcctcatctcggcccacacctcccttgcctgcggcccgatctacacc
ttcggcaccgaggagcagaagaaaaaatggctcccggacctgaacaccggcaaggtgatc
ggctgcttcctcctgaccgaaccggacgccggcagcgacgccggggccatcgccaccacc
tacaagcgcgacggcgatcatttcgtgatcaacggttcgaagatcttcatcaccaacggc
ggctacaagggaaccggcgtgctcttcgccacctccgacaaaaacctcaagcacaaaggg
gtctccgccttcatcatcgacctgcagtccccgggggtcgagatcctcaagaacgagaag
aagctcggcatccgcggcagctacaccaccgccttcgccctcgacagcgtccgcattccg
gtggagaacctcctagggcaggaagggcaggggttcaagatcgccatggacaccctgaac
ggcggccgcatcggcatcgcctcccaggctctcggcatcgccgaaggcgccttcgacctg
gcgcttgcctactccaaggagagaaagcagttcggccatcccatctgcgagctgcaggcg
atccagttcaagctggccgacatgtacgcgaagatcgagaccagcaagctcatgacctac
aaggctgcctgcctgaaggacagcaagaagaactacaccatggagtccgccatgtgtaag
atgctcgcctcggaggcggcaaccttcgtcaccaaggaggcgatccagatccacggcggg
tacggcttcatcgtcgactacgaggtggagcggatgtaccgcgacgcgaagatcaccgag
atctacgaggggaccaacgaggttcagcgcgttgtggtctcgaagctgctcttgtcttaa

DBGET integrated database retrieval system