KEGG   Geobacter bemidjiensis: Gbem_3375Help
Entry
Gbem_3375         CDS       T00749                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, FAD-dependent
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00564  Glycerophospholipid metabolism
gbm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Gbem_3375 (glpA)
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Gbem_3375 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 Pyr_redox GIDA Thi4 HI0933_like OGG_N Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACH40370
UniProt: B5EB78
LinkDB All DBs
Position
complement(3878859..3880472)
Genome map
AA seq 537 aa AA seqDB search
MTDRKERLDRLKSGEIFDLLVVGGGATGCGIALDAASRGLKVALAERRDFAGGTSGRSTK
LLHGGVRYLEAAVLHRDRVQFNLVRDALHERGVLLKIAPHLCQRLTLVTPLYRLAQVPYM
WAGLKFYDLLARGAGLGHSRYLSPSEMLRRFPQIKGKGLKGGVLYYDGQFNDARMNVALA
LTALREGAALSNYLEVVGLVREKGRVAGALVRDPLGGASWQIRARCVVNACGPSADLLRR
MDDPTAAPLLRLSRGSHIVLPGKFAPADTGIMIPKTEDGRVVFILPWQGMCLVGTTEEPA
TAGTTPVADDKDVDYLLRHLRRYFNLTVDEGDIMARWAGLRPLVHDPYTADTAELARDHV
ISCSPTGLITIVGGKWTTYRKMALDTVDFAVANMGLAPSGACRTDRIMLHGGKGFEAQGA
TVLAKRFALPPDVALHLHGSYGTLATDVAQLCQGELGERLVPPHPYLKGEVLYAVRNEMA
LSPSDFLERRIPLALLDQRGAQIAAPVVLEMMAQELGWSQVRVAHERSELSNLLEQG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacagaaaagagcgtctggacaggctgaaatcgggggagatctttgatcttctc
gtggtaggcggaggcgctaccggctgcggtatcgcgctcgacgcggcaagtcggggcctc
aaggtggcgctggccgagcggcgggatttcgccggcggcaccagcggcaggagcacgaag
cttttgcacggaggtgtgcgctacctggaggctgcggtcctgcaccgggacagggttcag
ttcaacctggtgcgcgacgcgctgcacgaacgcggcgtgctgttgaagatcgcgccccac
ctgtgccagcgattgaccctggtcacgccgctgtaccggctggcacaagtcccgtacatg
tgggccgggctcaagttttacgaccttttggcgcgcggggcgggcctcgggcacagccgt
tacctttccccttccgagatgctgcggcgttttccccagatcaaagggaaggggctcaaa
gggggagtcctctactacgacgggcagttcaacgacgcccgcatgaacgtcgcgctggcg
ctgaccgcacttagggagggagccgccctcagcaattatctggaggtggtcgggctggtc
cgggaaaaggggagggtagccggcgcactggtgcgggaccccttggggggggcttcctgg
cagatccgggcccgatgcgtggtgaacgcctgcggcccttccgctgacctcctgcgccgg
atggacgaccctacggccgcgccgcttttgcggttgagccgcggcagccatatcgtgctc
ccagggaagttcgccccggcagacaccgggatcatgatccccaagaccgaggacgggcgc
gtcgtcttcatcctcccctggcaggggatgtgcctggtcggcaccacggaggaacctgca
acggccggcactacgccggttgccgacgacaaggacgttgattacctgctgcgccacctg
cggcgctatttcaacctcaccgtggatgagggggacatcatggcgcgctgggccgggttg
aggccgctggtgcatgatccttacacggcggatacggcggagcttgcgcgcgaccacgtc
atcagctgctcccccaccgggctcatcaccatcgtcggcgggaagtggaccacctaccgc
aagatggcgctcgacacggtcgattttgctgtcgccaatatgggactcgcccccagcggg
gcatgccgcaccgaccgtatcatgctgcatggcggcaaggggttcgaggcgcagggggct
accgtgttggcgaagcgctttgcgcttccacccgacgtcgccctgcatctgcacggctcc
tacgggacattggcaacagatgtggcgcagctttgccagggagagctgggggagaggctg
gtgccgccgcacccctaccttaagggcgaggtgctttacgcggtacggaacgagatggcg
ctctctccctcggatttcctggagcggcgcattcctttggcgcttttggaccagaggggg
gcgcagattgcggctccggtggtgctggagatgatggcgcaggagttgggatggagtcag
gtgcgggtggcgcacgagcgatcggaactgtcaaacctgctggaacaggggtga

DBGET integrated database retrieval system