KEGG   Gordonia bronchialis: Gbro_0415Help
Entry
Gbro_0415         CDS       T01102                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
gbr  Gordonia bronchialis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACY19749
UniProt: D0LDC9
LinkDB All DBs
Position
464156..465196
Genome map
AA seq 346 aa AA seqDB search
MPPISPMLAKAVTDIPAQPDDADPVWSYEPKWDGFRALIFRDGDEVSIGSRGGKDLARYF
PEIVAAAKEELPEKVVLDGEIGVPAEIGGTHRLDWDTLAQRIHPAASRVNMLAETTPAIF
IGFDALALESADVMAEPFEVRRDTLLRAVGPGGRDRRFHVSRVTADPTLAQDWFSAFEGA
GLDGVVGKRLAGTYVEGKREMVKVKHKRTADCVIIGYRVHKSGTGVGSMLLGLHTDDGDL
HMVGGSSAFSDKKRIELQEQFEPMRLDPDKPAAGEPTRWRSEKSGEWIPIRPELVAEFAY
DQMENHRFRHTVKFLRWRPDRDPESCGYDQLEVPLTYDLHDVLEGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgatttcgccgatgctcgccaaggcggtcaccgacatacctgcccaacccgac
gacgccgacccggtgtggtcatacgagcccaagtgggatggcttccgcgcgttgatcttc
cgcgacggcgatgaagtgtccatcggttcgcgtggcggcaaggacctggctcgctacttt
ccggagatcgtcgctgcggccaaggaggaactgcccgagaaggtggtgctcgacggcgag
atcggtgtgcccgccgagatcggcgggacccatcgcctcgactgggacaccctggcccag
cgaattcatccagcagcctcgcgggtcaacatgctcgccgagacgaccccggccattttc
atcggattcgacgcgctggcgctggaatcggcggacgtgatggccgaaccgttcgaggtg
cggcgcgacacgctgctgcgggccgtcgggcccggtgggcgcgaccgtcgcttccacgtg
agccgggtgacagccgatccgactctcgcgcaggactggttctccgccttcgagggcgcg
ggcctcgacggtgtcgtcggcaaacggctggcgggcacgtatgtcgaaggcaaacgagag
atggtgaaggtcaagcacaagcggaccgccgactgcgtcatcatcggctaccgggtgcac
aagagcgggaccggcgtcgggtcgatgctgctcgggctgcacaccgacgacggtgacctg
cacatggtcggcggatcgagcgcgttctccgacaagaagcggatcgaattgcaggaacag
ttcgagccgatgcgtctggacccggacaagccggcggccggcgagccgacgcggtggcgg
tcggagaagtcgggggaatggataccgatccggcccgagcttgtcgccgaattcgcctac
gaccagatggagaatcaccggttccggcacaccgtcaagttcctgcggtggcgcccggat
cgcgacccggagagctgtggatacgatcagctcgaggtcccactgacctatgacctgcac
gacgtgttggaaggggcctga

DBGET integrated database retrieval system