KEGG   Gordonia bronchialis: Gbro_4532Help
Entry
Gbro_4532         CDS       T01102                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
gbr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Gbro_4532
Enzymes [BR:gbr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Gbro_4532
DNA repair and recombination proteins [BR:gbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Gbro_4532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACY23665
UniProt: D0L6V5
LinkDB All DBs
Position
4858722..4861115
Genome map
AA seq 797 aa AA seqDB search
MAPGDGTHLDVDGHRISITNLTKVLYPQTGTRKFEVIDYYSRIADVLLPHLRGRLVTRKR
WPNGVESTPFFEKDMPESAPAWITRHGIEHSQRVINYAVVDSRATLVWLAQMAALELHAH
QWRLPVIDDALRANRMVLDLDPGPGVPLTECAAVARLIRDLLADAGMDTYPVTSGGKGIH
VYARLPRPVSPDAARTLAKEIATRLSREHPDTITATMAKTHREQRIFIDWSQNSGSKTTL
SPYSLRGREQPWVAAPRTWDELDDPGLDQLLYTDVLDRVDERGDLLDGLDDDYPASGPPS
EQTEVHTPRPPTEDSTGTDDRQVINLREYRRKRDAAKTPEPFGDESHQSRTAQTAAPSGD
PIFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNLPTDPDQNRLAVRTEDHPMDYADFEGD
IPAGEYGGGHVSIWDRGTFTTEKWREKEIIVRLAGERVQGRYALIKTGDKNWLAHLMSDE
PRPIVPDSLSDPRPMLATDEDIEGLSESEWAFEGKWDGYRILLRYIGGELRLTSRSGIDM
TRDFPEIAEITEHLGLLDVVLDGEVVALDSTGRTNFTLLTSRNHTDEPYTLRLYLFDILY
LNGASLLRKTWTQRRELLEELAPAFRHSRYVEVPPLLPGPGQVAADHSREHNMEGVVAKR
RSSIYQQGRRSASWLKHKNWSDIEVVIGGWRPGRGSRENTIGSLLLGLPEETGLRYVGRV
GTGFTDAALASLAQELEPLRISRSPFLEKLDRPVASTAIWVLPKIVGEVRFMDWTTTGHL
RHPSWRGIRRDKLPGDL
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggcacccggtgacggcacacacctcgacgtcgacggccaccggatctcgatcaccaac
ctgaccaaggtgctctatccgcaaaccgggacacgcaagttcgaggtcatcgactattac
tcacgcatcgccgacgtactgcttccgcatctgcgtggccggctcgtcacgcgcaaacgc
tggcccaacggtgtcgaatccaccccgttcttcgagaaggacatgcccgagagtgcgccc
gcgtggatcacccggcacggcatcgaacacagtcagcgcgtcatcaactacgccgtggtg
gactcgcgggcgacgctggtctggctcgcccagatggccgcactggagttacatgcgcac
cagtggcggttgcccgtcatcgacgacgcgctgcgggccaatcggatggtgctcgacctc
gaccccgggccgggggtcccgctcaccgaatgcgcggcggtggcccggctcatccgcgat
ctgctcgccgacgccgggatggacacctacccggtcaccagcggcggcaagggaattcac
gtctacgctcgactcccccggccggtgtcaccggatgccgcgcgcacgctggccaaggag
atcgccacccgactcagtcgagagcatcccgacaccatcaccgcgacgatggcgaaaacc
catcgggaacaacggatcttcatcgactggagtcagaacagcggttccaagacgacgctg
tcgccgtattcattgcgcggtcgcgaacaaccctgggtcgccgcgccccgtacctgggac
gaactcgacgatcccggccttgatcagttgctctacaccgacgtcctcgaccgcgtcgac
gagcgcggcgatctgctcgacggcctcgacgacgactacccggcgtccggcccaccatcc
gagcaaaccgaagtgcacaccccaaggcccccaaccgaagacagcaccggcaccgacgat
cgacaggtcatcaacctgcgcgagtaccgccgcaaacgcgacgcggcgaagacacccgaa
ccgttcggagacgagagccatcagagccggacagcccaaaccgccgcccccagcggcgat
cccatcttcgtcatccaggagcatcacgcacgacggttgcactacgacttccgtctcgaa
cacgacggcgtcctggtgtcctgggcggtgccgaagaatctgccgaccgacccggaccag
aaccggctggccgtccggaccgaggatcatccgatggactacgccgatttcgagggcgac
atcccggccggcgagtacggcggcgggcacgtatccatctgggatcgaggcactttcacc
accgagaagtggcgggagaaggagatcatcgtccggctggccggggagcgggtgcagggg
cggtacgccctgatcaagaccggcgacaagaactggctcgcacatctgatgagtgacgaa
ccgcgccccatcgtccccgacagcctctccgacccaaggccgatgctggccaccgacgag
gacatcgagggactctccgaatccgagtgggccttcgagggcaagtgggacggataccga
atcctgttgcgttacatcggtggcgaactccgcctgacctctcgatcgggtatcgacatg
acccgcgacttccccgagatcgccgagatcaccgagcatctcggcctcctcgacgtggtc
ctcgacggcgaggtggtggccctcgattccaccggccgcaccaacttcaccctgctgacc
tcgcgcaaccacaccgatgagccatatacgttgcggctctacctgttcgacatcctttac
ctcaacggcgcgtcgctcctgcgcaagacctggacgcagcggcgcgaactcctcgaggag
ctcgcgccggccttccgccactcccgctacgtcgaggtgccacccctgctccccggtccg
ggccaggtggctgccgaccacagtcgcgaacacaacatggaaggtgttgtggccaaacgc
cgttcctccatctaccagcagggccgacggtccgcgtcgtggctcaagcacaagaactgg
agcgacatcgaagtcgtcatcggcgggtggcgacccggccgcggatcacgggagaacacc
atcgggtcgctgctcttgggcctgccggaggaaaccggcctgcgctatgtggggcgcgtc
ggaaccggattcaccgacgccgcgctggcctccctcgcccaggaactcgaacccctgcgg
atctcacggtcgccgttcctggagaagctcgaccgcccggtcgcgtcgacggcgatctgg
gtgctccccaagatcgtcggcgaggtccggttcatggactggaccaccaccggccacctc
cgacacccgagctggcgcggcatccggcgtgacaaactgcccggcgacctgtga

DBGET integrated database retrieval system