KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_0952Help
Entry
GbCGDNIH4_0952    CDS       T03156                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Pathway
gbs00970  Aminoacyl-tRNA biosynthesis
gbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GbCGDNIH4_0952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gbs03029]
    GbCGDNIH4_0952
Enzymes [BR:gbs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GbCGDNIH4_0952
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GbCGDNIH4_0952
Mitochondrial biogenesis [BR:gbs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GbCGDNIH4_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHJ66652
LinkDB All DBs
Position
1095113..1096612
Genome map
AA seq 499 aa AA seqDB search
MSALTDLTIAEARDGLRAKRFSARELTDAHLGAIEALNPRLNAYITVTPDQARAQADAAD
RVLASGEAGALTGIPVASKDMFCSEGIRTTAGSRILENFVPPYESAVTERMLRDGAVILG
KANLDEFAMGSANLTSAYGPVENPWKRHDDDAVLVPGGSSGGSAAAVAAHLALGATGTDT
GGSIRQPASYCGIAGIKPTYGRCSRWGIVAYASSLDQAGPFARTVRDNAILLRSMAGHDP
RDSTSAMREVPDFEAACQRGVKGLRIGLPREYVADGMSEEIRTLWQNGAAMLRAAGAEVV
EVSLPHTKHALAAYYIIAPAEASSNLARYDGVRFGHRSSDNRDLNDLYERSRAEGFGAEV
KRRIMVGTYVLSAGYYDAYYLKAQKVRALIARDFAEAFRSVDALLTPTAPSAAFAQGETI
DDPVAMYLNDVFTVPINLAGLPAMSIPAGLSATGLPLGLQIIGRAFDEETVFAVSAALEQ
AAAFTHRPVLRADTLNAGA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctgaccgatctgaccattgcggaggcccgggacgggctgcgcgcaaaacgt
ttttcagcgcgggaactgaccgacgcgcatcttggtgcgatcgaagccctcaatccgcgt
ctgaatgcctatatcaccgtgacgccggatcaggcgcgggcacaggccgatgctgccgac
cgcgttcttgcctccggtgaggcaggggcgctgacaggtattccggtcgccagcaaggat
atgttctgctccgagggcatccgcaccacggcaggcagccgcattctggaaaatttcgtg
ccgccttacgaaagcgcggtgacggagcgcatgctgcgtgacggggccgtgatcctcggc
aaggccaatctggatgaattcgcgatggggtctgccaacctgacctctgcttatggtccg
gtggaaaatccgtggaaacgccacgacgatgatgcggtgctggtgccgggtggttcttcc
ggcggttccgcggcggctgtggccgcgcatctggcgctgggggcaaccgggaccgatacg
ggtggttcaatccgtcagccggccagctattgcggcattgccgggatcaagccgacctac
gggcggtgcagccgctgggggattgtggcctacgcatcctcgctggatcaggctggtccg
tttgcgcgcacagtgagggataatgcgatcctgctgcgttccatggccggacatgatccg
cgtgacagcaccagcgccatgcgtgaggtgccggatttcgaggccgcctgtcagcgtggc
gtcaaaggactgcggatcggcctgccgcgcgaatatgtcgctgatggcatgagcgaggaa
atccgcacgctttggcagaatggtgccgccatgctccgtgccgccggggccgaggtggtg
gaggtcagcctgccgcatacaaagcatgctctggctgcctactacatcatcgcaccggcg
gaggcgtcctcgaacctcgcgcgttatgatggtgtgcggttcggccatcgctccagcgat
aacagggatctgaacgatctctatgagcgcagccgggctgaaggatttggtgccgaggtg
aagcgccgcatcatggtcggcacatatgtgctctcggccgggtattacgatgcctattat
ctgaaggcgcagaaggtgcgtgctctgatcgcccgcgatttcgcggaggctttccgctcg
gtcgatgcgctgctgaccccgaccgccccgagtgccgctttcgcgcaaggtgagaccatc
gacgatccggtggcaatgtatctgaacgacgtgttcaccgtgccgatcaatctggccggt
ctgcccgccatgtcgattcctgccgggttgagtgcaaccgggcttccgctcggcttgcag
atcatcgggcgggctttcgatgaggaaacggtctttgccgtgtcggctgcgctggaacag
gcggctgccttcactcatcgccccgttttgcgtgccgatactctgaatgctggagcctga

DBGET integrated database retrieval system