KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_1651Help
Entry
GbCGDNIH4_1651    CDS       T03156                                 

Definition
(GenBank) D-alanyl-D-alanine serine-type carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Brite
KEGG Orthology (KO) [BR:gbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GbCGDNIH4_1651
Enzymes [BR:gbs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GbCGDNIH4_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR SUKH-4
Motif
Other DBs
NCBI-ProteinID: AHJ65874
LinkDB All DBs
Position
1900548..1901918
Genome map
AA seq 456 aa AA seqDB search
MGGWTVGRIKADRAQASRAIAAEETPVMMVSPLRRSWRARLTPALFGKIVLRSTIIGGLH
VSAGAAFLTTAATGFSTTAYAQIGSERYSSIVVDANTGAVLSASSPDELRHPASLTKMMT
LYMLFEALRDRRVSLDDLVPVSDHAASMSPSKLGLVPGTRLTVEEAILGLVTKSANDAAA
AVGEMLGGSEEQFAQMMTIRARALGMTRTVFRNASGLPDPDQISTAHDMAVLARHLILDF
PSEYRYFSTPSFVFHRHVIPNHDRMLSIYPGADGLKTGYTNASGLNLVTSALRSDVRLIG
VVFGASNKYERDSHMAALLNAGFRQEGVQSDGMAVAQARAPSFISSAHASAMPVSARTRV
ARHQARVPAAREVEVAEAPVMPRSRLHRSVSVVQVGAFSTRAAAQRAATGAAHQDGGKVQ
VTPVMVKGQKLWRAQVQKISSLVKPSKARHTQVAAR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggggatggaccgtggggcgtataaaagctgacagagcgcaggcaagccgggccatt
gcagcagaggagacacccgtcatgatggtgtcccctctccgccgcagttggcgcgcccgg
cttacccccgccctgttcggcaagatcgtcctgcgcagcaccatcatcggcgggctgcat
gtgtctgcaggagccgcattcctcaccaccgcagcaaccggtttttccactacggcctac
gcccagatcggttccgagcgctacagctccatcgtcgtcgatgccaataccggggctgtt
ctttccgcctccagccccgatgaactgcgtcaccccgccagcctgaccaagatgatgacg
ctgtatatgctgttcgaggcattgcgggatcgccgggtctcccttgatgatctggttccg
gtctccgatcatgccgcctccatgtcgccctccaagctcgggctggtccccggcacaagg
ctgacggtcgaggaagccattctcggcctggtgaccaaatccgccaatgatgccgccgcc
gccgtcggtgagatgctgggcggtagcgaggagcagttcgcgcagatgatgaccatccgc
gcccgtgcgctcggcatgacccgcaccgtgttccgcaacgcatccggcctgccggacccg
gaccagatcagcaccgcccatgatatggctgtgctggcccgtcatctgattctcgatttc
ccatctgaatatcgttacttcagcacgcccagcttcgtgtttcaccgccatgtgatcccg
aaccatgatcgcatgctctccatctacccgggtgcggacgggctgaagaccggttacacc
aatgcatccgggctgaatctggttacatccgccctgcggagcgacgtcaggctgatcggc
gtggtgttcggcgcatcgaacaaatatgagcgcgacagccatatggcagcgctgctcaat
gccggattcaggcaggaaggcgtgcagtctgacggtatggctgtggcacaggcacgggca
ccgtccttcatctcctccgcccatgcgtcggccatgccggtttccgcacggacgcgggtg
gcccgccatcaggcgcgcgttcctgccgcacgggaggtcgaggtggccgaagcccccgtc
atgccgcgcagcagactgcaccgatccgtctccgtggtacaggtcggtgctttcagcacc
cgtgccgccgcccagcgggctgcgaccggagccgcccatcaagatggcggcaaggtgcag
gtgacacccgttatggtgaagggacagaagctgtggcgggcacaggtccagaaaatctca
tctctcgtcaaaccatccaaggcacgccacacacaggtggcggcccgttaa

DBGET integrated database retrieval system