KEGG   Gallionella capsiferriformans: Galf_2524
Entry
Galf_2524         CDS       T01295                                 

Definition
(GenBank) Leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00480  Glutathione metabolism
gca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Galf_2524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gca01002]
    Galf_2524
Enzymes [BR:gca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     Galf_2524
Peptidases and inhibitors [BR:gca01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   Galf_2524
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: ADL56523
UniProt: D9SCE2
LinkDB
Position
2717441..2718934
AA seq 497 aa
MEFSIKQSSPENQRSACVVLGVFEGGQLSPAAHIFDKAADHQLSRLVARGDMTGKSGSTT
MLHTLPGVTAERVLLVGLGKIEEFDAKRFLDMLRATFAALQKSICKDAALYLSDLAVIAR
DETWKINQIVLLAAESAYQCDQLKSKPADKPLLRKILLGCAKKPGNAAQTAIVQASAIAH
GMKLAKDLGNLPGNICTPTYLAEQSTKLASEHKLKVTILEEKDMGKLCMHSLLSVTRGSR
EPAKLITLEYRGADKKQKPVVLVGKGLTFDSGGISLKPGAEMDEMKYDMCGAASVLGTML
AIAKMSLNLNVIAVIPSSENMPDGAASRPGDIVKSMAGLTIEILNTDAEGRLILCDALTY
AARFEPDTVIDIATLTGACVIALGGVASGLFSNQDALAKELADAGEYANDKAWHMPLWDE
YQSQLDSNFADMQNIGGRAAGSVTAACFLSRFTKDYRWAHLDIAGTAWKSGKDKGSTGRP
VPLLARYLINRANAKGA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggaatttagcataaaacaaagcagtccggaaaatcagcgcagcgcttgcgtggtttta
ggcgtttttgagggcggacaactgtcccccgctgcgcacatcttcgataaagccgccgat
catcagctaagccggctcgtagcgcgcggcgacatgacgggcaaatcgggcagcaccacg
atgctccacacgctgccgggcgtcacagccgaacgcgtcttgctggtaggcctaggtaag
atcgaagaattcgacgccaaacgctttctcgatatgctgcgcgcgaccttcgccgcgctg
caaaaatccatctgcaaagacgctgcgctgtacctgtctgaccttgctgtcatcgcgcgc
gacgagacatggaaaatcaaccagatcgtcctgctcgccgccgaatcggcctatcagtgc
gatcagctcaagagcaaaccggccgacaaaccgctgctgcgcaaaatcctgctcggctgc
gcaaagaaacctggcaacgccgcacaaaccgccatcgtgcaagccagcgccatcgcgcac
ggtatgaaactggccaaagatctgggcaatctgccgggcaacatctgcacaccaacctat
ctggcagagcagtccacgaagctcgctagcgaacacaagctcaaagtgaccatactcgaa
gaaaaggatatggggaaactgtgcatgcattccttgctgtccgtcacgcgcggcagccgc
gaacccgccaagctaatcacgctggaatatcgcggcgcggacaaaaaacaaaaacccgtg
gtgctggtcggcaagggcctgaccttcgattcgggcggcatctcgctcaagccaggcgcc
gaaatggacgagatgaaatacgacatgtgcggtgcagccagcgtactgggcacgatgctg
gcaattgccaaaatgtcactgaatctcaacgtcatagcggtcattccgagtagcgaaaac
atgccggacggcgccgccagccgcccgggcgacatcgtaaaaagcatggccggcctcacc
atcgaaatcctcaacaccgatgccgaaggccgtttgatcctgtgcgatgcgctgacctat
gccgcgcgcttcgagccggatacggtaatcgatatcgcaacattgaccggcgcctgcgtg
attgcgctgggcggcgtggcaagcggcctgttcagcaatcaggatgcactggccaaagaa
ctggcagacgcgggcgaatacgcaaacgacaaggcatggcatatgcccttgtgggacgaa
tatcagtcgcaactggacagcaattttgccgacatgcagaacatcggcgggcgggcggca
ggcagtgtgacggccgcctgtttcctgtcgcgcttcaccaaggactatcgctgggcgcat
ctggatatcgccggcacagcctggaaatccggaaaagacaagggatcgaccggccgccct
gtaccgctgcttgcacggtatttgatcaatcgcgcgaacgctaaaggcgcatga

DBGET integrated database retrieval system