KEGG   Gallionella capsiferriformans: Galf_2671Help
Entry
Galf_2671         CDS       T01295                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca00020  Citrate cycle (TCA cycle)
gca00620  Pyruvate metabolism
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
gca01200  Carbon metabolism
Module
gca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_2671
   00020 Citrate cycle (TCA cycle)
    Galf_2671
   00620 Pyruvate metabolism
    Galf_2671
Enzymes [BR:gca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Galf_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADL56667
UniProt: D9SD69
LinkDB All DBs
Position
2878619..2879866
Genome map
AA seq 415 aa AA seqDB search
MAEIKQVLVPDIGDYKGVSVIEVMVKVGDTINEEDTLLTLETDKAAMDVPSPYSGIVKEL
HVEIGDKVSRGSLILVMESSDAAAPAAAPVAAPVIVAPVAAPVAVVAQTVQSVVSSGKAH
ASPAIRRFARELGADIAQIKGSGEKGRVTKEDVQNFIKAALAQPRGAAGGNGLQVLDMPV
FDFAKFGTIETRPLSRIQKISGANLHRNWVTIPHVTQFDEADITEMEAFRKQLGTEYAKQ
NIKITPLAFMLKAVVAALQKFPKFNASLDGDNLILKQYFHIGVAVDTPDGLMVPVLRDVD
KKGIVQLATELGEISTRARDKKITAADMQGGCFTISSLGGIGGTAFTPIINAPEVAILGV
SRSAMKPVYQDGVFVPRLMLPLSVSYDHRVIDGAAAARFTAYLAQVLSDIRRLAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaataaaacaggttttagtgccggatatcggcgactacaagggcgtcagcgtt
atcgaagtcatggtgaaagttggcgacacaatcaacgaagaagataccctgttgacgctg
gaaacagacaaggcggcgatggatgtcccctcaccctactccggcatcgtcaaggagtta
cacgttgaaatcggcgacaaagtgtcgcgcggttcgctgattctggtcatggaaagcagc
gatgctgcggctccagcagctgcaccggttgcagcgccggtaatcgtcgcaccagtcgct
gcaccggtcgccgttgtcgctcaaacagtgcagtccgttgtatcctcgggcaaagcacac
gcaagcccggccatccgccggtttgcccgcgaactgggtgcggacatcgcacaaatcaag
ggcagcggtgaaaagggccgcgtcaccaaagaagatgtgcagaacttcattaaggccgcg
cttgcccaaccgcgcggtgcggcaggcggtaacggcctgcaggtgctggatatgccggta
ttcgattttgcgaaattcggcacgatcgaaacccgtccgctgtcccgtatccagaaaatt
tccggcgcaaatctgcatcgcaactgggtgacgattccgcatgtcacgcaatttgacgag
gcggatatcaccgagatggaagccttccgcaagcaactgggtacagagtacgccaagcaa
aacatcaagatcacgccgctggccttcatgctcaaagcggtggtggcggccttgcagaaa
ttccccaagttcaacgcctcgctggacggcgacaatctgatattgaagcaatatttccat
atcggtgtcgcggtcgatacgccggatggactgatggtgccggtgctgcgcgatgtagac
aaaaagggcatcgtgcaactggccaccgagcttggcgaaatttcgacgcgcgcacgcgac
aagaaaattaccgcagcggatatgcagggcggttgcttcacgatttccagtctgggcggc
atcggtggcacggcgtttacgccgattatcaatgcgcctgaagtcgctattctgggtgta
tcgcgctcggccatgaaacccgtgtatcaggacggtgtatttgtgccgcgtctgatgctg
ccgctgtcggtctcctacgatcatcgcgtgatcgacggggcggccgcagcgcgtttcacc
gcctacctcgcacaggtgctgtccgacattcgccgactggcgctttag

DBGET integrated database retrieval system