KEGG   Glutamicibacter creatinolyticus: GcLGCM259_0985Help
Entry
GcLGCM259_0985    CDS       T05997                                 

Definition
(GenBank) Hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gcr  Glutamicibacter creatinolyticus
Brite
KEGG Orthology (KO) [BR:gcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gcr01001]
    GcLGCM259_0985
Enzymes [BR:gcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GcLGCM259_0985
Protein kinases [BR:gcr01001]
 Serine/threonine kinases: Other
  Bacterial family
   GcLGCM259_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Haspin_kinase Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: QCY46734
UniProt: A0A5B7WU20
LinkDB All DBs
Position
complement(1114993..1117329)
Genome map
AA seq 778 aa AA seqDB search
MSAPLHDHLTGQLLDDRYRLDELIGYGGMSRIYRAVDGRLHRPVAVKILNDNYARDPQVR
ERFASEAVIAANINHPNVVSTRDHNASGSLVYLVMEFVRGQNLHELISRRGRLTPRQTLN
VLESICRGLAAAHREGIVHRDMKPGNVLMADNGEVKITDFGLARVATAHTQSSTLLATLQ
YASPELVSGQPADSRSDIYAVGVMIFQMLTGQLPYPDATVPALMRHHLESETPLPSTRVP
GLAQDLDELVRFCTEKDPENRPQDAGFLLDEVIQIGTTLSDEQLDLGADTYGGIGDLIPE
AVQHPTTVQQRLDHWQREREAQRDPWWVRPNAAAAAAGAGQDGHDEPQAAQDPTTVLDAA
GQPTQALGADTPATEAHGSEPQAAGDREQRTGTEDAAADAGGDPREAHTTAYRQASEPAT
VAHERSGQHHAPATMAMPREERSGATAMAEESADEPPSKRELKRAQRQWRRQAQVPTHRL
GKPRSPAQKVLVSVLLLAVVALVAAGAWFFGRGPGSVVNIPSLSGLVQAQAVQRLESAGV
PVRVNNAYDDEVAPGRVIDSNPAEGENIMRFQGVELVISRGPELFQMPDVTGMDTSAARQ
RLQQMQLSAPSVGQEYSQSVDEGQVISSKPAAGEQLTRKTATSLVVSAGPAPVNVPSLVG
LDEQAARGAVEELGLSLQVGEPVYSSDVPRGQVAVQDPAEGTVPAGGSISVQLSQGPEYV
QIPSVIGQEVEQAVSALEQAGFQVETRDMLGGHSSTVRLQTPLNQQAERGATITLYVF
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccattgcacgaccatttgaccggccagctgctcgatgaccgctaccggctc
gatgagctgatcgggtacggcggcatgtcgcggatctaccgcgccgttgacgggcggctg
caccgtccggtggccgtgaagatcctgaacgacaactacgcgcgtgatccccaggtgcgg
gagcgttttgcctccgaggcggtgatcgcggcgaacatcaaccacccgaacgtggtctcc
acccgcgaccacaacgcctcgggcagcctggtctacctggtgatggagttcgtgcgcggc
cagaacctgcacgagctgatcagccggcgcgggcggttgaccccgcgccagacgctgaac
gtgctggagagcatctgccgcgggctggccgccgcgcaccgcgaaggcatcgtgcaccgg
gacatgaagccgggcaacgtgctgatggccgacaacggcgaagtgaagatcaccgacttc
ggcctggcccgggtcgccaccgcgcacacccagtccagcacgctgctggcaaccctgcag
tacgcctcaccggagctggtctccggccagccggcggattcgcgcagtgacatctatgcg
gtgggcgtgatgatcttccagatgctcaccggccagctgccctacccggatgcgaccgtg
ccggcgctgatgcgccaccacctggaatccgaaaccccgctgccctccacccgtgtgccg
ggcctggcccaggacctggacgagctggtgcgcttctgcaccgagaaggacccggagaac
cggccacaggacgccgggttcctgcttgacgaggtgatccagatcggcaccacgctcagc
gacgagcagctggatctgggagcggacacctacggcgggatcggtgatctcatcccggag
gcggtgcagcaccccaccaccgtgcagcagcgcctggatcattggcagcgcgaacgcgag
gcgcagcgcgacccgtggtgggtgcggcccaacgccgccgcagccgcagccggcgccggg
caggacgggcacgatgagccgcaggccgcgcaggatccgaccacggtgctcgatgccgcg
ggccagccgacccaggcgctgggcgccgacacgccggccaccgaggcccacgggagcgag
ccgcaggcggccggggaccgggagcagcggaccggtaccgaggatgccgctgcggacgcg
ggcggggatccgcgcgaagcgcacaccaccgcctaccggcaggccagcgagccggcgacc
gtcgcccacgagcgttccgggcagcaccacgccccggccaccatggccatgccccgcgag
gaacgttccggggccaccgccatggcggaggagtccgccgacgagccgccctcaaagcgg
gagctgaagcgggcgcagcgccagtggcgcaggcaggcgcaggtgcccacccaccggctg
ggcaagcccaggagcccggcgcagaaggtgctggtctcggtgctgctgctggccgtggtg
gccctggtcgcggccggggcgtggttcttcgggcgcgggccgggcagcgtggtgaacatc
ccctcgctcagcggcctggtgcaggcccaggcggtgcagcgcctggaatccgccggggtg
ccggtgcgggtgaacaacgcctatgacgacgaggtcgcccccgggcgggtgatcgactcg
aaccccgccgagggtgagaacatcatgcgcttccagggggtggagctggtgatctcccgg
ggcccggaactgttccagatgcccgatgtgaccgggatggacacctccgccgcccgccag
cggctgcagcagatgcagctgtcggccccgagcgtgggccaggagtactcacagagcgtg
gacgaggggcaggtgatctccagcaagccggccgccggggagcagctgacccgcaagacc
gcgacctccctggtggtttccgccggcccggcaccggtgaacgtgccctccctggtgggg
ctggatgagcaggccgcccggggggccgttgaggaactgggcctgagcctgcaggtcggc
gagccggtgtattccagcgacgtcccgcgcggccaggtggccgtccaggacccggccgag
ggcacggttccggccgggggcagcatcagcgtacagctttcccagggcccggagtacgtg
cagatcccctcggtgatcggccaggaggtggagcaggcggtgtccgccctggagcaggcc
gggttccaggtcgagacccgtgacatgctcggcgggcactccagcacggtgcgcctgcag
acgccgctgaaccaacaggccgagcgcggcgcaacgatcacgctgtacgtgttctaa

DBGET integrated database retrieval system