KEGG   Glutamicibacter creatinolyticus: GcLGCM259_2669Help
Entry
GcLGCM259_2669    CDS       T05997                                 

Definition
(GenBank) Hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gcr  Glutamicibacter creatinolyticus
Pathway
gcr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GcLGCM259_2669
Enzymes [BR:gcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GcLGCM259_2669
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GcLGCM259_2669
    1.1.1.-  
     GcLGCM259_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C FAD_binding_3 adh_short ADH_zinc_N_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: QCY48376
LinkDB All DBs
Position
complement(2976870..2977931)
Genome map
AA seq 353 aa AA seqDB search
MKAARYYDRKDIRIEDIDEPTLQPGTVAIDVAWCGICGTDLHEYLEGPIFVPPAGHPHPI
SGESAPVTLGHEFSGTITALGEGVTDLEVGQNVVVEPYIIGDDVDTSEGQPYQLSENMNF
IGLGGRGGGLAEKIVVERRWVHPVGDIPLDQAALIEPLSVGHHAFVRSGAKAGQVAIVGG
AGPIGLLTAAVLKAEGLTVYISELSEARKAKARETGVADEIFDPREVDVAEKIRELTGGK
GADVGFECSSVPVVLDMLIDAVRPAGVIVNVSIWGRKPEVDMPNLVLKEIDLRGTIGYAN
DHPDTIELVSSGKLDLAPFITGRIGLDELVSEGFDQLINNNEHHVKIIVNPRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcgcgctactacgaccgcaaggatatccgcatcgaggatatcgatgaaccg
acgctgcagccggggactgtagccattgatgttgcatggtgcggcatctgcggtaccgac
ctgcatgagtacctcgaaggaccgattttcgttcctcccgcaggacatccgcatccgatt
tccggcgagtcggctccagtcaccctgggccacgagttctcgggaacgattaccgctttg
ggcgaaggggtcacggacctcgaagtgggacagaatgtggttgttgagccctacatcatc
ggtgacgatgtagataccagtgagggtcagccctaccagctgtccgagaacatgaatttc
attggcttgggtggccgcggtggtggtctggcagagaagatcgtggtggaacgccgctgg
gtacacccagtcggtgacattccgctggatcaggcagccttgatcgagccgctctctgtg
ggacatcacgcgttcgtccgttccggcgcaaaggcgggacaggtcgccatcgttggcggt
gcaggtccgatcggtctgctgaccgccgcagtgctgaaggccgaaggcctgaccgtatac
atttccgagctctccgaagcccgcaaggccaaggcgcgggaaaccggcgttgccgatgag
atctttgatccccgcgaggtggatgttgcggaaaagatccgtgaactgaccggcggtaag
ggtgctgacgtcggtttcgagtgctcctcggtaccggtggtgctcgacatgctgatcgac
gccgtgcggccagcgggcgtgattgtgaacgtctcgatctggggtcgcaagcccgaggtc
gatatgccgaacctggtgctgaaggaaatcgatctacgcggaaccatcggatacgccaac
gatcatccggacaccatcgagttggtctccagcggcaagctcgatctggctccgttcatt
accggacgcattggcctggacgaactggtctccgaaggctttgaccagctcatcaacaac
aatgagcatcacgtgaagatcattgtgaacccccgggcctag

DBGET integrated database retrieval system