KEGG   Geobacillus sp. C56-T3: GC56T3_0210Help
Entry
GC56T3_0210       CDS       T01245                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00473  D-Alanine metabolism
gct01100  Metabolic pathways
gct01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GC56T3_0210
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GC56T3_0210
Enzymes [BR:gct01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GC56T3_0210
Peptidoglycan biosynthesis and degradation proteins [BR:gct01011]
 Precursor biosynthesis
  Racemase
   GC56T3_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADI25279
LinkDB All DBs
Position
234736..235890
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGHGDAQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVISIDDVARHLGTINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggacgccatttacgacaac
gtcgcgaatttgcgccgctttttgccggagggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgcccaagtggcggcaacggcgctcgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggggcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtgtttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacgggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggagtgtatacgcattttgcgaccgctgatgaagtgaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgtcgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgttcaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccatacgaa
ttgaaagaggcgttttcgctccatagccgccttgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatt
ccaatcggttatgcggacggctggttgcgaaggttgcagcactttcatgtgcttgttggc
gggcagcgggcgccgatcgtcggccgtatctgcatggaccaatgcatgatccgcctgccg
gagccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccatcgatgatgtcgcccgccatttgggcacaatcaattatgaagtgccgtgcacgatc
agctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaacgcc
gttggccgcggatga

DBGET integrated database retrieval system