KEGG   Geobacillus sp. C56-T3: GC56T3_0427Help
Entry
GC56T3_0427       CDS       T01245                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GC56T3_0427
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GC56T3_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADI25483
LinkDB All DBs
Position
455563..457044
Genome map
AA seq 493 aa AA seqDB search
MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP
APKRAEILYKVGMLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFG
DTTPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPAPETPIM
AQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGRMIAEKCGRL
LKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQELERR
LLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLVGGYILREGDYAR
GFYYAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLEEAIAVNNSVDYGLSSAIFTRDVN
NVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWRSIYVDF
SGKLQRAQIDTDD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatccaaaactatatcaatggagaatggaaggagccaagcaccgggcaatttgcg
ccggtgatcaatccggcgacgggggaaacgattgccgaggtggcgatgtccgggccaaac
gatattgatgaggccgttcaagcagccaaagaagcgcagaaacagtgggcgctcgtgccg
gcgccgaaacgcgcggaaatcttgtataaagttgggatgctgctaaaggagcggaaagaa
cagctggcccggctgttgacgatggaaatgggcaaagtgattgaggaagcgcgtggcgaa
gtgcaggaaggcattgatatggcgttttacatggcgggagaaggacggcggttgttcggc
gatacgacgccgtctgaactgaaagacaaatttgccatgagcgtccgcacgccggttgga
gtggtcggcatcatcactccatggaattttcccattgccatcgccacttggaagtcgttt
ccggccattgttgccggcaatgcggtcgtatggaagccagcgcccgagacaccgatcatg
gcgcaggaattagctcgcatttttgaagaagcgggcttgccgccgggagtgtttcatgtg
gtccacggtgacgggccgacagtcggcaatgcgctcgtcgagcatcctgatgtcaaggtc
atctcatttaccggatcgaatgaagtcgggcggatgattgcggaaaaatgcggacggctg
ttgaaaaaggtgtcgcttgaaatgggaggaaaaaacgccgtcattgtgatggatgatgcg
gatttgacattggcggttgacggcatcatctggagtgcgttcggtacatcaggccagcgg
tgcacggcgtgcagccgggtcatcgtccatgagcgggtgaaacaggagcttgagcggcgt
ctgcttgaagctgtgaaaacattgaaaatcggcaacgggttggatgaaacggtcaaagtc
ggacccgtcatccatgaagaggcgctgcaaaaaatcgaccgctacgtgcgcattggcgta
gaagaaggggcgaaactgcttgtgggcggctatatattgcgcgagggcgactatgcgcgc
ggcttttattacgcgccgacgattttcaccgatgtcacgccgaatatgcgcatcgcccgc
gaagaaattttcggcccggtcgtgtcgatcatttccgtccgcagtttggaagaagcgatc
gccgtcaacaacagcgtcgattatgggctgtcaagcgccattttcacacgcgatgtcaac
aatgtattccgagcgatgcgcgatttggacaccggcatcgtgtatgtcaacgccggcaca
acgggagcggaaattcatttgccgtttggcggcacgaaagggacgggcaacggccaccgc
gactccggcgtcgctgcgcttgacgtattcaccgaatggcggagcatttatgtcgatttc
agcggcaagctgcaacgggcgcaaatcgataccgatgattga

DBGET integrated database retrieval system