KEGG   Geobacillus sp. C56-T3: GC56T3_0495Help
Entry
GC56T3_0495       CDS       T01245                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00071  Fatty acid degradation
gct00362  Benzoate degradation
gct00650  Butanoate metabolism
gct01100  Metabolic pathways
gct01120  Microbial metabolism in diverse environments
gct01200  Carbon metabolism
gct01212  Fatty acid metabolism
Module
gct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GC56T3_0495
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GC56T3_0495
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GC56T3_0495
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GC56T3_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADI25549
LinkDB All DBs
Position
531373..533760
Genome map
AA seq 795 aa AA seqDB search
MVKRIRRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEEEAKGWTLEHKQVRNR
LANQALERLLKQKPAPLMSKDNIALIETGNFEDDFHRLAEVDWIIEAVVEKLEVKKEVFA
RVDEVRTPGTIVSSNTSGISIAAMAEGRSDDFKKHFLGTHFFNPPRYLKLLEIIPTEHTD
PDVVAYMKSFGEDVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMQGGYSVGEVDSVTG
PLIGRPKSATFRTLDVVGLDTFVHVANNVYENVEGEEKEAFRVPEFMKTMLENGWLGSKS
GQGFFVKQGKDILELNYVTMQYEPRKKLVTPAVEMAKQAKGAAAKLQTLVYADGDRAGTL
LWNIIAPTLLYTARLVGEIADDIVAIDQAMKWGFGWEQGPFELWDAIGLEKSVRKMQAEG
RDIPSWITDMLADGATSFYKTENGRLFYYAPGGYKTVEENEKVIHIRRLKEARGVIKKNA
GASLIDLGDDVALLEFHSPNNAIGADIVQMINEALEEVNRNYKGLVIGNQGKNFCVGANL
AMMLMEAQDENFFELELAVRQFQQALLKMKYNPKPVVVAPFAMTLGGGAEVSLAASRIQA
AAETYIGLVEVGVGLIPGGGGNKELYIKRLNSLPRGVDVDYVKIAASVFETIAMAKVSTS
AAEARELGFLNHRDGITMNGDHLLYEAKQAVLSMYEEGYRPPVRKKVPVAGESGYAAMLL
GAQSMFHSGYISEHDLKIAKKLAYVLAGGKVPYGTEVDEQYLLDLEREAFLSLIGEPKTQ
ARMQHMLVKGKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacgcattcggcgcgccgcggtgctcgggtccggcgtcatgggttcgggcatt
gccgcccatttggcgaacgtcggcattccgacgctgctgttggatatcgtgccgcgggaa
ttgacgaaagaggaagaagcaaaaggttggacgctcgagcataaacaagtgcgcaaccgc
ctcgccaatcaggcgctggaaaggctgctcaagcaaaaaccggcgccgctcatgtccaaa
gacaacatcgctttgattgaaacgggcaacttcgaggatgacttccaccggctcgcggaa
gtcgattggatcattgaagcggtcgttgaaaagctggaagtgaaaaaagaagtcttcgct
cgcgtcgacgaggtgcggacgccggggacgatcgtcagctcgaacacatccggcatctcg
atcgccgcgatggcggaggggcgttcggatgatttcaaaaaacactttttaggcacgcat
ttcttcaatccgccgcgctatttgaagctgcttgagatcatcccgacggagcatacggat
ccggacgtcgtcgcctatatgaaatcgttcggcgaagacgtgctcggcaaaggcgtcgtc
atggcgaaagatacgccgaacttcatcgccaaccggatcggcacgtatggcttgctcgtc
accgtccgcgagatgatgcaaggcggctacagcgtcggcgaggtcgattcggtgacgggg
ccgctcatcggccggccgaaaagcgcgacgttccgcacgcttgacgtcgtcgggctcgat
acgttcgtgcatgtcgccaacaacgtgtatgaaaacgtcgaaggggaagaaaaagaggcg
ttccgcgtgccggagtttatgaaaacgatgcttgaaaacggctggctcggcagcaaatcc
ggacaaggcttttttgtcaagcaaggaaaagacattctcgagctgaactacgtcacgatg
caatacgagccgcgcaaaaagcttgtcaccccggcggtggagatggcgaagcaggcgaaa
ggagcggccgccaagctgcaaacgctcgtgtatgccgatggcgaccgcgcgggaacgctc
ctttggaacatcatcgcaccgacattgctgtacaccgcccgccttgtcggggagatcgcc
gacgacatcgtggcgatcgatcaggcgatgaagtgggggttcggctgggagcaaggtccg
tttgaactgtgggatgcgatcggcctcgagaagtcggtgcgcaaaatgcaggcggaaggg
cgcgacatcccgtcgtggatcacggacatgctcgccgacggagccacatcgttctataaa
acggaaaacggccggctgttctattatgcgccgggcgggtataaaacagtagaagaaaac
gaaaaagtcatccacatccgccgactgaaagaggcgcgcggcgtcatcaagaaaaatgcc
ggcgccagcctcattgacctcggcgacgacgtggcgcttctggagttccattcgccgaac
aacgcgattggcgccgatattgtccaaatgatcaacgaggcgcttgaggaagtcaaccgc
aactacaaaggtctcgtcatcggcaaccaagggaaaaacttctgcgtcggcgcgaacttg
gcgatgatgctcatggaggcgcaagacgaaaacttttttgaattggaacttgccgttcgc
cagttccagcaagcgcttctcaaaatgaaatacaacccgaagccggtcgtcgtcgcgccg
tttgccatgacgttaggcggcggggcggaagtgagcttggcggcttcgcgcatccaagcg
gcggccgagacgtacatcgggctcgtcgaagtcggcgtcggcttgattccgggcggcggc
ggcaacaaggagctgtacatcaaacggttgaacagcctgccgcgcggcgtggacgtcgac
tacgtcaaaatcgcggccagcgtatttgaaacgatcgccatggcgaaagtgtcgacgtca
gcggcggaagcgcgcgagcttggcttcttgaatcaccgtgacggcatcacgatgaacggc
gaccatctgctgtatgaagcgaaacaggcggtgctctcgatgtatgaggaagggtaccgg
cctcctgtaaggaagaaagtgccggtggccggcgaaagcggctatgccgccatgctgctt
ggggcgcagtcgatgttccattccggctacatcagcgagcacgatttgaaaatcgcgaaa
aaattggcgtatgttctagccggcggcaaagtgccgtacggaacggaagtcgacgagcaa
tatttgctcgatctcgagcgcgaggcgtttttgagcctcatcggcgagccgaagacgcaa
gcgcgcatgcagcatatgcttgtgaaaggaaaaccgctccgcaactaa

DBGET integrated database retrieval system