KEGG   Geobacillus sp. C56-T3: GC56T3_0498Help
Entry
GC56T3_0498       CDS       T01245                                 

Definition
(GenBank) arsenate reductase-like protein
  KO
K00537  arsenate reductase (glutaredoxin) [EC:1.20.4.1]
Organism
gct  Geobacillus sp. C56-T3
Brite
KEGG Orthology (KO) [BR:gct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GC56T3_0498
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     GC56T3_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC Glutaredoxin GST_N_3 Ish1 DUF3134 DUF836
Motif
Other DBs
NCBI-ProteinID: ADI25552
LinkDB All DBs
Position
536962..537327
Genome map
AA seq 121 aa AA seqDB search
MALTLYWYPKCGTCRKAKRWLDEHGVDVRTVNLVDEPLTKEELARLHRQSGLPLKKFFNT
SGMKYRELGLKDKLDRASEDEMLDWLASDGMLVKRPILTDGERVVVGFREQEYEAFFAAG
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctctattggtatccaaaatgcggaacgtgccggaaggcgaagcgttgg
ctcgatgaacacggcgttgacgtgcggacggtgaacttagtcgacgagccgctgacgaaa
gaggagctcgcccgtttgcaccgtcaaagcgggctgccgctcaaaaaatttttcaacacg
agcgggatgaaataccgcgagcttggcttgaaggacaagctcgaccgcgcatcggaagac
gagatgctcgattggctcgcctcggacgggatgttggtcaaacggccgattttgacggac
ggcgagcgggtcgtcgtgggctttcgcgaacaagaatacgaggcgtttttcgcggcgggg
acataa

DBGET integrated database retrieval system