KEGG   Geobacillus sp. C56-T3: GC56T3_0758Help
Entry
GC56T3_0758       CDS       T01245                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00020  Citrate cycle (TCA cycle)
gct00480  Glutathione metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
gct01210  2-Oxocarboxylic acid metabolism
gct01230  Biosynthesis of amino acids
Module
gct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gct_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GC56T3_0758
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GC56T3_0758
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GC56T3_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADI25803
LinkDB All DBs
Position
811100..812371
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFADKVFTWAQYDRIVETEGKEAANKALADAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtctggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtcgcgctccgtcaagagctcgacctgtttgtctgcttgcgc
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgggaaaacacggaagacatctacgctggcattgaatatgccaaaggcacg
ccggaagtgaaaaaagtcatcgactttttgcaaaacgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcattaaaccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactacgcgatcgaacacggccgcaagtcggtgacgctcgttcat
aaagggaatattatgaaattcaccgaaggcgcgtttaaaaactggggttatgaactggcg
gaggaagaattcgccgacaaagtgttcacgtgggcgcaatacgaccgaatcgttgaaacg
gaaggcaaggaagcggcgaacaaagcgcttgctgatgcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggcaaacatcaactacgaaaccggccacgcgatt
ttcgaagcgacgcacggcacggcgccgaaatacgcagggcttgacaaagtcaacccgtcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaacgatcgctgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcgacggaagtgaaatgctccgaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system