KEGG   Geobacillus sp. C56-T3: GC56T3_0917Help
Entry
GC56T3_0917       CDS       T01245                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gct  Geobacillus sp. C56-T3
Brite
KEGG Orthology (KO) [BR:gct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GC56T3_0917
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GC56T3_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_7 Thioredoxin_4 FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADI25960
LinkDB All DBs
Position
976487..978016
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPNISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMSSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggatgctgacatcaaggcgcaactagctcagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgccgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaatcgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcaggggcaaacatcatttt
gaaacgtacgtcagcttgacttgccacaactgcccggacgtcgtgcaagcgctcaacatc
atgagcgtgttaaacccgaacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacggcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggacgct
tcttccttcgccgacaaagagccgtttgatgtgctggtgatcggcggcggccctgcaggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactggcattgtcgcggagcgc
ttcggcggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaagaacatgtaaagcaatacaacgtcgacatc
atgagctcgcagcgggcaaaacggctcgagaaaaaagacttgattgaagtcgagctggaa
aacggcgctgtgttgaaaagcaaaaccgttgtcatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcactgc
gacggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcagcgattgacctcgctggcatcgccagccatgtgacgctgctggagttcgcccct
gaactcaaggcggatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggagaagaacatcatatcgaattgcagggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
atcattgttgataaacgcggcgcaacgaacattgaaggcgtctttgccgcaggcgactgc
acggacagcgcctataagcaaattattatctcgatgggctcgggtgcaaccgcggcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system