KEGG   Geobacillus sp. C56-T3: GC56T3_1296Help
Entry
GC56T3_1296       CDS       T01245                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01130  Biosynthesis of antibiotics
gct01230  Biosynthesis of amino acids
Module
gct_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GC56T3_1296
Enzymes [BR:gct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     GC56T3_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH Tudor_1_RapA
Motif
Other DBs
NCBI-ProteinID: ADI26322
LinkDB All DBs
Position
1346981..1348081
Genome map
AA seq 366 aa AA seqDB search
MIERTIETATKRYPLLLGDGAARVLPSLLRSLSCPPGTKLFIVTDDTVAPLYLDEVRALL
AAAEYDVYAYVIPSGEAAKSFDHYYACQTAALQCGLDRRSVIIALGGGVVGDLAGFVAAT
YMRGIRYIQMPTTLLAHDSAVGGKVAINHPLGKNMIGAFHQPEAVVYDTSFLRTLPEREL
RSGFAEVIKHALIRDRRFYDWLRAEIKTLADLRGEKLAYCIEKGIDIKASVVREDEKETG
VRAHLNFGHTLGHALESELGYGALTHGEAVAVGMLFAVFVSERFYGRSFAEHRLADWFAG
YGFPVSLPTTVQTRRLLEKMKGDKKAYAGTVRMVLLCEIGDVEVVELEDDNLLTWLDEFS
RQGGKG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacggacgattgaaacggcgacgaagcgctatccgcttcttttgggcgatggg
gcggcccgcgtgctgccaagcttgcttcggtcgctctcctgtccgccagggacaaaactt
ttcatcgttaccgacgatactgtggcgcctctttatttggatgaggtgcgggcgttgctt
gccgccgctgagtatgacgtgtacgcctacgtcattccaagcggggaggcggccaagtca
tttgatcattattacgcttgccagacagcggcattgcagtgcggcctcgaccgccgctcg
gttatcattgcgcttggcggcggcgttgtcggcgatttggctgggtttgtcgccgccacc
tatatgcgcggcatccgttacattcaaatgccgacgacactcttggcccatgacagcgcc
gtcggcggcaaagtcgccatcaaccatccgctcggcaaaaatatgatcggcgccttccat
cagccggaagcagttgtgtatgacacctcctttttgcgcacgctgcccgagcgcgagctt
cggtccgggtttgccgaggtgatcaaacatgcgctgatccgcgaccgccgcttttacgac
tggctgcgcgcggaaatcaagacgctcgccgacttgcgcggcgagaaactcgcctattgc
attgaaaagggcattgacattaaggcgtccgtcgtgcgtgaggatgaaaaagaaaccggg
gtgcgcgcccatttgaatttcggccatacgctcggccatgcgctggaaagcgagttaggc
tacggcgcgctcactcacggggaggcggttgcggttggcatgctgtttgccgtctttgtc
agcgaacggttttacggccggtcgttcgctgagcatcgattggccgactggttcgccgga
tacggcttcccggtgtcgctgccgacaacggttcagacgcgccgcctgcttgagaagatg
aaaggcgacaaaaaagcgtacgccggaacagtgcggatggtgcttctctgtgagatcggc
gatgtggaagtggtggaactcgaagacgacaacctgctcacgtggctggacgagttttcc
agacagggggggaaaggatga

DBGET integrated database retrieval system