KEGG   Geobacillus sp. C56-T3: GC56T3_2549Help
Entry
GC56T3_2549       CDS       T01245                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00020  Citrate cycle (TCA cycle)
gct00310  Lysine degradation
gct00380  Tryptophan metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
Module
gct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GC56T3_2549
  09105 Amino acid metabolism
   00310 Lysine degradation
    GC56T3_2549
   00380 Tryptophan metabolism
    GC56T3_2549
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GC56T3_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ADI27507
LinkDB All DBs
Position
complement(2691257..2694109)
Genome map
AA seq 950 aa AA seqDB search
MAKQTNYAQPWSQFYGPNLGYVIEMYEQYLDDPNSIDPELKQLFEQWGAPVLEEPVSPAD
DETAKTHQTFRLPETPTIFSKLVAAVKLADSIRHYGHLAADTNPLVKKEKKLRRLELDEY
DLTEEDLKRIPVAFLCPHAPAHVKNGWDAILHLRKIYTDKIAFEFSQVHNLEERNWLIQQ
IESGAYYPSLANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQ
AIEHEIDAVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKNFIPSEGSVAITYGWTG
DVKYHLGAARRLRNKSAHTMRITLANNPSHLEVVNPVVLGYTRAAQEDRTKPGVPVQNTD
ASFAILIHGDAAFPGQGIVAETLNLSQLRGYTTGGTIHIIANNMIGFTTESYDSRSTTYA
SDMAKGFEVPIVHVNADDPEACLAAACLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMA
TNPTMYAIINQHPTVRQLYAQKLMEKGIITEREVDEMEQEVAERLKIAYERVPKNEDELD
FIMDPPKPVVDRLPEVKTGVAKDVLHRVNEELLQFPDGFNVFNKLERILKRRSGVFAQNG
KVDWAHAEILAFATILQDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGEEYVPLHHISGAK
ASFVVYNSPLTEAAVLGYEYGYNVYAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKWG
QKSGLVMLLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLSTAAQYFHILRRQAALLT
REEVRPLIIMTPKSLLRHPLAASDAEAFVDGAFSPVLEQPGLGADAGKVERIVFGTGKLM
IDLAEQIGKMEGLDWLHIVRIEELYPFPEEAVKDIIARYPNVKELVWVQEEPKNMGAWLY
MEPRLRALAPEGVDVSYIGRRRRASPAEGDPVVHRKEQERIIRCALTKHE
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagacgaactacgctcaaccgtggagccagttttacgggccgaacctcggt
tatgtcatcgaaatgtatgaacaatacctcgatgaccctaacagcatcgacccggaactg
aagcaactgtttgaacagtggggggcgccggtcttggaagaaccggtttctcctgcggat
gacgaaacagccaaaacgcatcaaacgttccggctgccggagacgccgacgattttcagc
aagcttgtcgctgccgtcaagctggcggacagcattcgccattatggccatctggctgcc
gatacgaatccgcttgtcaaaaaggagaaaaagctgcgccgcttggagcttgacgaatac
gacttaaccgaagaggatttaaagcgcattccggtcgcgtttctttgcccgcacgctccg
gcgcatgtcaaaaacggctgggacgccatcttgcatttgcgcaaaatttacacggacaaa
atcgcgtttgaattctcgcaagtacataatctcgaagagaggaactggctcattcagcaa
atcgagtccggagcgtattacccgagcttggcgaacaaagagcgggttgctttgttgcgc
cgcctgacggaagtggaagggtttgaaaagttcatccaccggacgtatgtcgggcaaaaa
cggttttcgatcgaagggcttgattccatggtgccgcttttggatgagctcgtccgccaa
gcgatcgaacatgaaatcgacgccgtcaacatcggcatggcgcaccgcggccggttgaac
gtgctggctcacgtgctcggcaagccgtacgaaatgattttcgccgagtttcagcatgcg
gaaagcaaaaatttcattccgtctgaagggtcagtggcgatcacgtacgggtggacgggc
gatgtcaaataccacttaggggcggcgcgccgccttcgcaataaaagcgcgcatacgatg
cggattacgctcgctaacaacccaagccatctcgaagtggtcaatccggttgtgcttggc
tacacgcgcgccgcgcaagaagatcggacaaaaccaggagtgccggtgcaaaatactgat
gcgtcgtttgccatcttgattcacggcgatgccgcgttcccgggacaagggatcgtcgcg
gaaacgctcaacttaagccagctgcgcggctatacgaccggcgggacgatccatatcatc
gccaataacatgatcggctttacgacggagagttacgattcacgctcgacgacgtatgct
tccgatatggcgaaagggtttgaggtgccgattgtgcacgtcaatgccgacgacccggag
gcttgtttggcggccgcatgcttggcgtttgcctaccgccagcggtttaaaaaagacttt
gtcattgacctaatcggttaccgccgcttcggtcataatgaaatggatgagccgatggcg
acgaacccgacgatgtacgcgatcatcaaccaacatccgaccgtacgccagctgtatgcg
caaaaattgatggaaaaagggatcatcaccgagcgggaagtcgacgaaatggagcaagag
gtggccgaacggctgaaaatcgcctacgagcgggtgccgaaaaacgaagacgaactcgat
ttcatcatggatccgcccaaaccggtcgtcgatcggctgccggaagtgaaaacgggcgtg
gcgaaagacgtgctccatcgtgtgaacgaagaattgctgcagtttccggacggattcaac
gtctttaacaagcttgagcgcattttaaaacggcgaagcggcgtgtttgcgcaaaacggc
aaagtcgattgggcgcacgcggaaattttagcgtttgccacgattttgcaagacggcgtg
ccgatccgcttgactgggcaagattcgcagcgcggcacgtttgcgcagcgccatttggtg
ctccatgacgtgaaaaccggagaagagtatgtgccgcttcaccacatcagcggcgccaaa
gcgtcgtttgtcgtgtacaacagcccgctgacggaagccgctgtgctcggctatgaatac
ggctacaacgtttacgcgccggagacgctcgtgctttgggaagcgcaatttggcgacttc
gccaacatggcgcaagtgatgtttgatcaattcatttcatccggccgggcgaaatggggg
caaaaatccgggcttgtcatgctattgccgcacggctacgaagggcaaggccctgaacat
tcaagcggccgcgtcgagcgctttttgcagctggcggcggaaaacaactggacggttgcc
aacttatcgacggccgcgcaatatttccatattttgcggcggcaggcggcgctgttgaca
agagaagaagtgcgtccgctcatcattatgacgccaaaaagcttgctccgccatccgctg
gcagcgtcggatgcggaagcgttcgttgacggtgcgttctcgccggtgctcgaacagccg
ggattgggcgctgacgctggcaaagtggaacgcatcgtgtttggcaccggaaaattgatg
atcgatttggcggaacaaatcggcaaaatggaaggtcttgactggctgcatatcgtgcgc
attgaagagctgtatccattcccggaagaagcggtgaaagacatcatcgcccgctatccg
aacgtcaaagagctcgtctgggtgcaagaagaaccgaaaaacatgggggcatggctgtat
atggaaccgcgcctgcgggcgttggctccagagggtgttgatgtcagttacattgggcgg
cgccggcgggccagcccggcggaaggcgatccggtcgtccaccgaaaagagcaagagcgc
atcatccgctgtgcattgacgaagcatgaatga

DBGET integrated database retrieval system