KEGG   Geobacillus sp. C56-T3: GC56T3_2812Help
Entry
GC56T3_2812       CDS       T01245                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00071  Fatty acid degradation
gct00350  Tyrosine metabolism
gct00625  Chloroalkane and chloroalkene degradation
gct00626  Naphthalene degradation
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_2812
  Lipid metabolism
   00071 Fatty acid degradation
    GC56T3_2812
  Amino acid metabolism
   00350 Tyrosine metabolism
    GC56T3_2812
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GC56T3_2812
   00626 Naphthalene degradation
    GC56T3_2812
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GC56T3_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADI27756
LinkDB All DBs
Position
2948078..2949088
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHKFKQKLQIEEVEKPKLGYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEVGEGVKSIKIGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGSY
AEYCKAPADYVARIPKNLDPVQVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKAELAAKLGADITINGLREDPVATIREKVGGVHAAISVAVT
KKAFEQAYQSVRRGGCLVIVGLPHDELPIPIFDTVLNGVTIKGSIVGTRKDMQEALDFAA
RGKVRPIVEAVPLEKINEVFERMEKGQINGRIVLTM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttgttcacaaattcaaacaaaaacttcaaattgaagaagtggagaaa
ccaaaactagggtatggcgaagtgcttgtgaaaattgaagcttgtggcgtctgccatacc
gatttgcatgcggcccatggagattggccggtaaaaccgaaacttccgcttattcctggt
catgaaggagtaggaatcgttgttgaggtcggcgagggagtgaaatcaatcaaaattggc
gaccgtgttggcattccatggttatactcggcatgcggtgaatgtgaatattgtttaagc
ggtcaagaaacactttgtccacatcaattaaatggtggatactctgtcgatggcagttat
gcagaatattgcaaagccccggccgattatgtcgcacgaattcctaaaaatctcgatcct
gtacaagttgctcctattctttgtgctggagtcacaacgtataaagcattaaaagtttca
aatgccaagcctggtgaatgggtcgctatttatggaatcgggggattgggccatattgct
cttcaatatgccaaagcaatgggattaaatgtcgttgctgttgatatcagtgatgaaaag
gcagagcttgcagcaaagttaggagctgatattacaatcaatggcctgcgtgaagacccc
gtagcaacaattcgtgaaaaagtaggcggagtgcatgcagctattagcgttgctgtaacg
aaaaaagctttcgaacaagcctatcaatccgttcgacgcggtggttgccttgtcatcgtt
ggactgcctcacgatgaactaccgatccctatttttgacactgtattaaatggcgttaca
ataaaaggttcgatcgtcggtacacgaaaagatatgcaagaagctttagatttcgccgca
cgcggaaaagttcgccccattgtggaagcggtaccattagaaaaaattaacgaagtattt
gaacggatggaaaaaggccaaatcaatggccgcattgttttaacaatgtaa

DBGET integrated database retrieval system